SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016022 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016022
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.22e-31
Family Ubiquitin-related 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016022   Gene: ENSLACG00000014109   Transcript: ENSLACT00000016133
Sequence length 100
Comment pep:known_by_projection scaffold:LatCha1:JH127143.1:963535:981299:1 gene:ENSLACG00000014109 transcript:ENSLACT00000016133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQEANSSTQPGEKKEGEYIKLKVIGQDNSEIHFKVKMTTQLRKLKESYCQRQGVPSNS
LRFLFEGQRISDHQTPKELGMEDEDVVEVYQEQTGGAWRT
Download sequence
Identical sequences H3B2A1
ENSLACP00000016022 XP_006000222.1.90931 ENSLACP00000016022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]