SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001113 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001113
Domain Number 1 Region: 541-782
Classification Level Classification E-value
Superfamily VPS9 domain 8.76e-55
Family VPS9 domain 0.00097
Further Details:      
 
Domain Number 2 Region: 97-200
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000269
Family SH2 domain 0.0038
Further Details:      
 
Domain Number 3 Region: 799-873
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000103
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001113   Gene: ENSLACG00000000996   Transcript: ENSLACT00000001124
Sequence length 902
Comment pep:known_by_projection scaffold:LatCha1:JH127769.1:8136:39982:-1 gene:ENSLACG00000000996 transcript:ENSLACT00000001124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLASSEVVPAHCTSWLMTALCLRKRHSFSKLVDSFASEIGELKQEMVQIDPMLDDGPTLS
EKSSLTQDMDSLHLDDKEPKSFARDSGYDSLKNKLSILDRLLQTHPVWLQLSLSDENAAE
ILKSQHPGIFLVRKSVSLQKKVISLRLPNDFGICVQDFAIKESQYTFSLEGSAISFADLF
RLIAFYCISRDVLPFTLKMPHAIIAAKTETELDEISQMGPKFWNSPANSKANSPSPPSRP
HPSDSVCRVSRHVPVINGVHSIRTRTPSELECSQTNGALCFINPLFLEVHSSDISGSTKR
QSIRSKEENGTEIPRSPPPRPPPPSISNILRSPALKKNMKEASMPGADSYYKHDSGTPEK
KPTPIPPPRPKKQASLSEVEGKMVSASPTGSCYKKAPEQVVARTLGEAAVEQHLNLGNRG
LTTEPESRVQESEGRQRLSDMSISTSSSDSMDFEPNIFLPHHEGDTNSSLEDFEGESDQE
SMAPPLKHKKKRTSSFVLPRIVKTQFRKVSGVFSSLMTPEKRMIKKIAEMSRDKCTYFGC
LVQDYVSFLQENTECHVSSTDMLQTIRQFMTQVKNYLEQSSELNPPIESLIPEDQIDVVL
EKAMHKCILKPLKSHIETTLKKFHNADGSWKQLKENLQLAKQKKPQDLGVYAPAPDSVTL
EKIKHKFITMQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPMLTYVLAQCEM
PQLDIEIEYMMELLDPSLLHGEGGYYLTSAYGAISLIKNFQEEQAARLLSSETRNTLRQW
HKRRTTNRTIPSVDDFQNYLRVAFQEVNNGCTAKTMVVKPYTTTEEVCNICAQRFKVQDP
DNYSLFLLIEDTWQQLTEDTYPQKIKAELHSRPQPQTYHFVYKRISSDLLTLTTVENCNT
SL
Download sequence
Identical sequences H2ZUP2
ENSLACP00000001113 ENSLACP00000001113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]