SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001146 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001146
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000143
Family Ubiquitin-related 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001146   Gene: ENSLACG00000001027   Transcript: ENSLACT00000001157
Sequence length 297
Comment pep:known_by_projection scaffold:LatCha1:JH129766.1:8769:38308:-1 gene:ENSLACG00000001027 transcript:ENSLACT00000001157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPMSEWCIAVKLADQPLAPKSILQLPESDPGDGMLSGYSISALKHLIAGKLPESAPDPEL
IELIYCGRKLKDEQTLDFYGIQPGSTIHVLRKSWPEPEQKPEPVDRVAAAREFRVLHTAL
HTSPAYRDAVYKMLGNKESLDQILVATPGLSSDPVALGVLQDKDLFTVFTDPNMLDTLIT
SHPALVNAIVLVLHSVAGIAPPAPTDGSSRSMPSSSYSDMPGGFLFEGLSDEEEDFQQNT
RSGPSTSTASGSRPLTLGYSGAAGPRPITQSELATALALASTPESSAHTPTPGTQVQ
Download sequence
Identical sequences H2ZUS5
ENSLACP00000001146 ENSLACP00000001146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]