SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001652 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001652
Domain Number 1 Region: 229-369
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-25
Family Third domain of FERM 0.0058
Further Details:      
 
Domain Number 2 Region: 109-210
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-20
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 3 Region: 14-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-17
Family First domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001652   Gene: ENSLACG00000001478   Transcript: ENSLACT00000001665
Sequence length 553
Comment pep:known_by_projection scaffold:LatCha1:JH128767.1:20057:88873:-1 gene:ENSLACG00000001478 transcript:ENSLACT00000001665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFKSYKNDKMTQEHRNIRVLLPNKEQLSVVIGVKAIAQELFNQVCDLVKIKEPHFFGLSI
FKNNEHIFMDLEQKLSKYFPKEWKKETGKGTETLGTPFVACFTVQYYVENGRVIGDKTAR
HLYYCQMKEQVRKSQCVQKEEIYFLLAAYALQAELGNYKKKVHIGKYFEPQDYFPQWIQV
IRHGCRIFMSHARNKHKNKILCTSEEALLKVMDGSSLKGKVLVHVFFFFHDKKEECPSIV
LGLTLKGMYIYQEVNHIRQLLYDFPWSNVGKLTFLGKKFEIQPDGLPSARKLVYYTGCPF
RSRHLLQLLSNSHRLYLNVQPVLKQIRKAEETEEKKRYRESYISDTLEMDLDQLDKHSHG
SGSSRSSLRNNHLSRQSTVSHSSSHTSGIEADSRHRIIEQGHRTGQSYSSGISRGSSRTS
GFDSGSKGRVGYDSHDDEIELAVDEPVEIPVDSPLEITQRDGLGHVKQDLLNALHHGCHS
ELVLYVSSASAYDPLVKLRGQSIDSLERVARSKHKTSTDRHSQSLDDVRLYQQQSPLSAT
ISSDTSQSYTFGC
Download sequence
Identical sequences H2ZW81
ENSLACP00000001652 ENSLACP00000001652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]