SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000002268 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000002268
Domain Number 1 Region: 2-549
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.45e-84
Family Acetyl-CoA synthetase-like 0.0000267
Further Details:      
 
Domain Number 2 Region: 772-1116
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.12e-45
Family Quinoprotein alcohol dehydrogenase-like 0.0093
Further Details:      
 
Domain Number 3 Region: 563-619
Classification Level Classification E-value
Superfamily ACP-like 0.00000654
Family Peptidyl carrier domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000002268   Gene: ENSLACG00000002026   Transcript: ENSLACT00000002286
Sequence length 1122
Comment pep:known_by_projection scaffold:LatCha1:JH127144.1:37945:89542:-1 gene:ENSLACG00000002026 transcript:ENSLACT00000002286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTLHEMVLQTAALHENKPAVCFDECRKGAPIWYTYRDVTDLAKELTDFLQKHCHLESSCE
IGLYCAPGIHLPSWILGILQAPAAYSPIDPEAPSDLSYYFMKKCTLKYILVQNDMVEKFT
NRFSSWFHFDAFSVQKLNVTLFKVKWKETDAELLPTPMGGEAGNGSDKGDLEKLRVKNLD
CSDGSVSTEYMDRRQPECLAYVLHTSGTTGLPKIVRVPHKCIVPNIQHLRRSIFEITPDD
ILFLASPLTFDPSVVEMFLALTTGASLLIVAPVVKMIPQKLADVLFNRHRVSVLQATPTL
IRRFGAQLLRSTVLSARTSLRVLALGGEAFPSLHALRSWMETGNTTRIFNLYGITEVSSW
ATCYRIPESLLESTSELEFNIPLGFPLMGTTVEIRDVNHCVTDQGEGQVFIGGRERVCFL
DSEVVVPLGRTRETGDWVAVKDGHVYFIGRRDSQVKRHGKRLNLEYIQQVSERLSQVEAC
VVTCCEQGNLILFVVPSDTYAGEDREILQELRKRLPSHAVPDQLMVVETLPFTAHGKVDL
AELKKVFLTHKKVRQFDNELKGREELWESLQGLWKSLLGVAEGTLSVSQDSMFLYCGGDS
LKALRLAEEINNLVGRSIPGLLEVILDDPLLGIYNHVLETMQLTKPRATIKSSKRRQGED
SGAVLHGEKIKRWKADAPSDQAGGELKSIALSRGGCMLQLTVDVVADCEFALNCDKGRED
NTEVLNENVDPFHGAVTDGPSNIETSDVHQAARSRDLGEKPDLQAAGEMRVRARWRSDTG
KCVDASPLLVIPGSSDLAATVFIGSHSHRIQAINLHSGRIRWERVLGDRIESSACVSKSG
KLIVVGCYDGLVYVLQCSDGATHWTFPAGSSVKSSGAVDSETGLVFIGSHDQHIYALNIH
LSRQEQGKKCVWKLHCGGGAVFSSPCLIASPRLLYAATLEGLLLAVNPDSGKVIWKHSCG
KPVFSSPQCAQKCVFVGCVDGNFYCFSHAGEKLWQYSTSGPVFSSPCVSSFTNKVFSGSH
DGFIYCFSLEGDLLWQFKTSAKVYSTPFVFHDRDLDDRPLIAVISTDGSLWILDTESGLL
KASYKFPGEVFSSPVVWEKTLTVGCRNDYVYCMELSPAKQVH
Download sequence
Identical sequences H2ZXZ7
ENSLACP00000002268 ENSLACP00000002268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]