SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000002711 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000002711
Domain Number 1 Region: 621-711
Classification Level Classification E-value
Superfamily TAFH domain-like 8.5e-35
Family TAFH domain-like 0.0000372
Further Details:      
 
Domain Number 2 Region: 857-904
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000753
Family TBP-associated factors, TAFs 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000002711   Gene: ENSLACG00000002425   Transcript: ENSLACT00000002733
Sequence length 1070
Comment pep:novel scaffold:LatCha1:JH127461.1:48841:255662:1 gene:ENSLACG00000002425 transcript:ENSLACT00000002733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASDPLEDMLFSEVDEKAVSDLVGSLESQLAGQRAAAPPQSEMRTAGAVSNHLGIPSA
QVSAVQQLEEEEGKGQQGAAGLNQESSSRLGSSVKNVTPVFGSPTSAFGGSSSTSGSGVN
DVNSSEMQSHGAASSCLPAANAPELVTLPSSLVSVRPSNGGAGVLGSAAAGTGTATAEPL
KNPGVSTVRTVSSGVPSVNGSSGVVNSSTAGIASYCAGAGAALAVNTIVTSRSVVVSTVN
SNLTVASNTSSTAFTANRIAFPPSQTSVVVDSASTPTIALQRPPMHISSIAQNGNGTSNS
PALIQSVARVGTPAEITQVVNHQSTVVSPKVDSITQSKLVLQSRPGTINTLTNSVTPVMN
LPTNSPQNSVAKSVPVVSSPVSHNTIVKPGIHVLGPSGSSVGVLKPGIPPPIMSTATQSQ
PPRPGVGPPQRIGPQLIVRPPQQTTIHLPPGLTIPPGKVISCIIYNDNILHAAGVSIYSI
FSGMILIRTETGQLIMVPQQALAQAQAHAQGHTSSSVSSRLSTTSGQVFRSSSTQLGRLA
AVTPAMGRKKTPRIQSPQGLPRTQVSNQPGVQTQAHAQAIPGSPSPGINTVSQVCFTLGY
KHCNTHKKKGGGRLWTLRKPEEEMQENVKKCKNFLATLIKLASHNPPSPETSRNVKSLVQ
DLLDAKINPEEFTCRLQTELKSSPQPYLVPFLKKSLPALRQTLLNSQSFMQVQQQGQNSQ
LVGTYNRRTGGRSIFAYHPSYVVSTGVVNVWPMGRRSGLAGEIKKKTTQVRMPVVITQSI
RQPVLQQKKLIGVFAKGTVGKVPTIQTSKSPGGVGVEVSANVKNKLNDPGGGSYRYMTLS
FFTFKYFLCVGGFFSKLSLRWLGIAIRLIAKRFGVTEVPNEVVSFVSHATQDRLRSMIEK
VTVIAQHRMETYKDDEWYEQATDVRSQLKFFEQLERLEKQRKDEQEREILLKAAKSRSRQ
EDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKLDLPGPTAAGGEGSGVS
NGAQAGPGAATSRQYSRQRITRVNLRDFIFCLEQEQNTSHSLMLYRALLK
Download sequence
Identical sequences H2ZZ90
ENSLACP00000002711 ENSLACP00000002711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]