SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003192 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003192
Domain Number 1 Region: 174-317
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-37
Family Third domain of FERM 0.0038
Further Details:      
 
Domain Number 2 Region: 71-176
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-33
Family Second domain of FERM 0.000044
Further Details:      
 
Domain Number 3 Region: 4-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-22
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003192   Gene: ENSLACG00000002851   Transcript: ENSLACT00000003222
Sequence length 552
Comment pep:known_by_projection scaffold:LatCha1:JH128741.1:61537:182422:1 gene:ENSLACG00000002851 transcript:ENSLACT00000003222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVFLQRDTKGQFLFDHVCNHYSLLEKDYFGIRFVDPEKQRHWLEFNKSILKQMKSHPPYT
VCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGAYIVQAELGDYD
PEEHSDDYISEFKMFPKQSQKLERKITEIHKSELRGQCPAVAEFNLLQKAHSLETYGVDP
HPCKDSTGTTAFLGFTATGFVVFQGNKRIHLLKWADICKLKFEGKTFYVIGVQKEKKVVL
TYHTCTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSSIFFKGSRFRYNGRVAKEVIEA
SLKIQRDPPEVHRSSIAQSRSSQSLTRQLIMNVEPLQPQVPSPKALEERSLRDEVPVPER
ISLEAPALKEPSIGELGEKLEPITAEEDKIKGEPLTISELVYSPSTSVLPTPVEDGGIDM
LFESSMRREREKEETDSFEELEADETALLLAEEEEMKEVRKVLNQSYDLLTGNKQLNAFV
RSFIRLLLVSFGLLVLTFPLLLVLLESDVDVSFLHEIRQTPEFEEFHYEYYCPLRQWVAC
KINFILDKLGCS
Download sequence
Identical sequences H3A0M1
ENSLACP00000003192 ENSLACP00000003192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]