SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007979 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007979
Domain Number 1 Region: 883-1175
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.46e-82
Family Complement components 0.0000106
Further Details:      
 
Domain Number 2 Region: 1258-1376
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.96e-28
Family Alpha-macroglobulin receptor domain 0.0017
Further Details:      
 
Domain Number 3 Region: 718-773
Classification Level Classification E-value
Superfamily E set domains 0.0000000168
Family SVA-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007979   Gene: ENSLACG00000007061   Transcript: ENSLACT00000008045
Sequence length 1429
Comment pep:known_by_projection scaffold:LatCha1:JH128367.1:253214:374143:-1 gene:ENSLACG00000007061 transcript:ENSLACT00000008045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTFLIAAPKHICLGSNTTLSVALFGGEHPEVQVAAEIFNGSTVLANAEDTYRNGSVGTLV
LPAIFLDTDQVNLQLVVKGYAQNTLLFSNSSSLTLLSKNMSVFIQTDKSLYKAGQGVKIR
VVSVNPDLKPYKGQIDIVIMDPKENRIQQWLAVSTNMGVVSKEFQLSENPPLGDWMIQAI
INGVITTKYFTVAQYVLPKFEVILHNSPTYLLSKQENLTGTVTAKYTYGKPVKGYAVVTV
STNMHYLQKINISKRIEINGSADFSFSYLDLITLTPYYNILYSINMKEVKLLLTAVVTES
LTGIKRNSSATVSIKEMEYSLQFFGGSQILKPSLNFTVYLNVSRYDNKQLTIEERKNMVT
VHINQDPQLMDIIQVRTQSFGNNTDFMQKFKTLNFTYTVPESGIIKIQVPVEAQNNYLSI
EAYFQNTLQQHYVSVVFNSPSNTYIQIRDPHSTGKVGSPIEVVIDGTEMIKEINYLVVAR
GQIVTVGKKSANTFTLTPEQSWMPTARVIVYYVKDSGEVVNDAMTVSTEGLIQNSVLLSW
SKNQATPAENISLSVTVREPNSLVGLLVVDKSAKLLGNKNDITSDAVAEELKKYMPENSI
VITSPTSVFKKCNLLVLTDADLPVDNTKKKSLLLQSERNMTKTSILYFVNLRNFAHVVRE
PRVRSHFPETWIWIDTNTGSETNKKIDVTVPDSITSWIASAFVISENLGLGLTTEFAQLR
AFQAFFVSLNLPYSVTRGEEFILEVTIFNYLKTSLEVMVTLELNGSFDILAGSDDINTIV
NQRQESVPSQDGKTVFFPISPQQLGEIPIKVTATSSAANDSVSRKVLVKAEGIEQSYSQT
VLLDLAGANPQSVKKTLNFTFPLDVVHGSEKACVTVVGDILGPSITGLESLIQMPYGCGE
QNMINFAPNIYVLKYLTATQQMKDDIKQKSLSFMEQGYQRELTYQRSDGSFSAFGNSDSS
GSTWLSAFVLRCFLQACPVIYIDKSVLNKTAMWLVDNQKLTGEFGEPGRVIHTELQGGLN
GPVTLTAYVLTAFFEDEKLSNTYKDKVLAAVNFTEGKLAQGIADNYTLSIVAYALSLAGS
SQASTALNELIQRADKQDGTMFWSSPASGLTSGWQPRSTDVELAAYALLSHLKQNRVTEG
IPIMKWLSQQRSHLGGYSSTQDTIVALQALSEFESLSASSTVNLMVSVTGSGISVPITLH
VDSNNVLLLQTKEIGIQQPMSIDITSSGNGLAIFQFNVFYNLKSSVAARKRRDVDNHEAF
DLDIIVYDDPKDVNNITLTICLRFENVTKTGMAVMEVDLLSGFAAAEDGIATNDLIKNIE
FQENKVVLYFDSLNATEVCVDILAVRESKVAKSKDATVIVYDYYEPKRRAQRSYLSTVMS
KMSSCEFCGDNCTLCQSNVKRMAQCCVLSQVLYYYKGCDLTLFIDNIWY
Download sequence
Identical sequences H3AEA8
ENSLACP00000007979 ENSLACP00000007979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]