SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008047 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008047
Domain Number 1 Region: 12-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.37e-33
Family GABARAP-like 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008047   Gene: ENSLACG00000007121   Transcript: ENSLACT00000008113
Sequence length 130
Comment pep:novel scaffold:LatCha1:JH126593.1:257009:260352:-1 gene:ENSLACG00000007121 transcript:ENSLACT00000008113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMPPFERSQELRPFKQRKCFATRKDEVTNIKSKFPNKLPVIIERYSKEKVLPLLPKTKFL
APPELSLCQFVTIIRIRNRMAIESNQAFYLLVNNRTLCGMSLTLAEIYAHNQDEDGFLYM
TYASQEMFGA
Download sequence
Identical sequences H3AEH6
ENSLACP00000008047 ENSLACP00000008047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]