SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008439 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008439
Domain Number 1 Region: 175-317
Classification Level Classification E-value
Superfamily PH domain-like 4e-36
Family Third domain of FERM 0.0029
Further Details:      
 
Domain Number 2 Region: 71-177
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-31
Family Second domain of FERM 0.0000837
Further Details:      
 
Domain Number 3 Region: 3-71
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.44e-23
Family First domain of FERM 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008439   Gene: ENSLACG00000007471   Transcript: ENSLACT00000008507
Sequence length 544
Comment pep:known_by_projection scaffold:LatCha1:JH127105.1:278202:344413:-1 gene:ENSLACG00000007471 transcript:ENSLACT00000008507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLCFLQRDAKGQYLFDLICHHLNLLEKDYFGIRFVDPEKQRHWLEFTKSIARQMKSQPPY
TMCFRVKFYPPDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDY
DPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKAELSGQVPAMSELNFLRKAQTLETYGVD
PHPCKDVSGNAAFLAFTPFGFVVLQGNKRIHFIKWSEVTKMKFEGKTFYIYASQKEEKKI
ILTYFAPTLEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVM
ESSAKIKREPPEIHRAGLVPSRSCPSITHGPRLGSVPRTRRRAVHISIMEGLESLRDSAH
STPVRSASHNSAFIPHSKSSLAEGSERAAVFSDEVYSPADSVLPTPVAEHNLELLLSRQS
NGAPCSIEEEKESEAGTPTATEAGEVRGESKASDQDIHGIGAAEVEQVNKFVLSVLRLLL
VTIGLLFVLLLLLIILTESDLDIAFLRDIRQTPEFEQFHYQYFCPLRRWFACKFRSVVSL
LIDT
Download sequence
Identical sequences H3AFL8
ENSLACP00000008439 ENSLACP00000008439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]