SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009109 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009109
Domain Number 1 Region: 275-413
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-25
Family UBX domain 0.01
Further Details:      
 
Domain Number 2 Region: 3-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000204
Family Thioltransferase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009109   Gene: ENSLACG00000008040   Transcript: ENSLACT00000009178
Sequence length 528
Comment pep:known_by_projection scaffold:LatCha1:JH127870.1:316545:337169:1 gene:ENSLACG00000008040 transcript:ENSLACT00000009178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWFEGSIPAAIALAKQKNSVFVVFIVGDDDQSIQMAGSWEDEIVAGESIKDFVAIKINA
KSEACVQFSEIYPVVCIPSSFFIGDNGVPLEVIAGSVSAEELINRIQKVKQMHEQKGTVH
PSDGGQLTSSVATQLSPAPVDPEPVSQSQSTPLENVDCAETCASNTKAKEPRPAASKESL
SKPVEDGINSAEAVGVTESEATARSSQNDDEDLDIKVERITKKLEEKREQKKKEEEQNEI
RKEVERRKIGKEMLEFKKRQEQEQTKRILEERNREKAEEKAARERVKQQIAMDRAERAAR
YAKNKEEVEAAKAAALQARQAELEARKEAVQRERSTVARIQFRLPDGSSFTNQFPSESRL
EEARRFAAQEVGRRYGNFSLATMFPRREFTKEDYVKSLLELELVPSASIVLLPAARPVVS
IVQSSGGGFWAFLGTIFYPLIAVWRFVSSLLFAGPSPQPGSQGAASKPERPTPAVSKATE
TSREGIRKRVLEKRGEEFKKEGKIYRLRTQEDSEDDNNTWNGNSTQQM
Download sequence
Identical sequences H3AHI8
ENSLACP00000009109 XP_006006250.1.90931 ENSLACP00000009109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]