SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009825 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009825
Domain Number 1 Region: 183-303
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-24
Family Third domain of FERM 0.0036
Further Details:      
 
Domain Number 2 Region: 84-181
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-24
Family Second domain of FERM 0.0013
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-21
Family First domain of FERM 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000009825
Domain Number - Region: 379-429
Classification Level Classification E-value
Superfamily RING/U-box 0.00012
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009825   Gene: ENSLACG00000008664   Transcript: ENSLACT00000009901
Sequence length 443
Comment pep:known_by_projection scaffold:LatCha1:JH127423.1:361126:408343:-1 gene:ENSLACG00000008664 transcript:ENSLACT00000009901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCFVTRPDSVVMEVEVDTKANGEDCLNQVCKKLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKFRVKFFVEPHLILQEQTRHLFFLHVKEDLQAGHLQCSPEQAVELS
ALLAQAELGDYNQNTAKYSYRDLCAKEPSTTTLNSIILKHKALEGTSQASVEYQALQVVS
ALENYGVEWHSVRDSEGQKLAIGVGPEGILVCKEDFSLANRIAYPVIQMATQSAKSVLLT
VSKESGNSVVLLFKLISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNDSINLGKKYVFDIRRTSKEVYDHARRVLYNAGLVDFVPRSDQSRQSSPLKSSESAINC
CEGLSCQQSKALQEKLRKLKEAMLCMVCCEEEINSTFCPCGHMVCCKPCASQLELCPICR
SHVEHVQHVYLPGCTSLFNLTVI
Download sequence
Identical sequences H3AJK4
XP_006002927.1.90931 ENSLACP00000009825 ENSLACP00000009825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]