SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010060 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010060
Domain Number 1 Region: 21-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000143
Family Ubiquitin-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010060   Gene: ENSLACG00000008867   Transcript: ENSLACT00000010137
Sequence length 524
Comment pep:known_by_projection scaffold:LatCha1:JH126867.1:379548:405825:-1 gene:ENSLACG00000008867 transcript:ENSLACT00000010137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQHPSARSCSRRATACEAISNEPSMNLHINTTTGTRYELSVPLEETVEGLKRRLSQRLK
VPKERLALLHKETRLNSGKLQDFGITDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLT
ETQSPPKKKNRSLRCGGGEILYMLSLLWKVYWHSRISGHLTALRSQETFSVNDFLSGRSP
LTLALRIGDHMMFVQLQLAAQQTGSQLQHRHVIASRGDNAGATGPSGHHRQPHSGTSSNF
SHIPVSTCQQTSSSSAVPSTPTAPMYCNTAHPSPVTSGMFRSHGTSTSTANHNIASPCPE
ADCTTRSSSSSSSAVTSRSRKPGAIIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDI
GTILQILNDLLSATRHYQGVPQSLTQLRCQTQCAPSSPPPSLPSLELSTKTTSEKTTAQP
LHSVVQCQSQIRMCKPNGDRLRQTENRATRCKVERLQLLMQQKRLRRKARRDARAPYQWL
PNRKSSRTNSNSSVSSEGSLDLDFEDSVWKPEVKADMKSEFVVA
Download sequence
Identical sequences H3AK89
ENSLACP00000010060 ENSLACP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]