SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000011150 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000011150
Domain Number 1 Region: 10-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.45e-18
Family Ubiquitin-related 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000011150   Gene: ENSLACG00000009812   Transcript: ENSLACT00000011233
Sequence length 393
Comment pep:known_by_projection scaffold:LatCha1:JH127786.1:451181:472052:-1 gene:ENSLACG00000009812 transcript:ENSLACT00000011233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDMWREDGGPVTLVIKSPNLKFEDQEVRGASFSWTVRRLKTHLAQVYPSHPGENEQKL
IYSGKLLLDHLQLKDVLRKGEDRHTLHLVCSNRNSQRSSEQPATIKVTETKEQPAPSAST
HEVLTSTSVHGDGLRHRSDPQNLPPAQGTTVGDVGTDHQTPELTGFAAYTMYSPQQLFWL
QQMYARQYYMQYQAAVAAAAITPPSTSFQQIPVVPPPAPPALPNQVPAVNLPVNQNVVPA
QPNNPAGNQNLRMNAQGGPLMDEDEDVNRDWLDWMYTFARVSIFLSILYFYSSVGRFIMV
MSTMILMYLQHVGWLPFRERPVPPEANQVPAAVENQVRNNPVDPVPSNAMHCCNIFYLFD
HEPEAPTYASTAWVFFKTFFASLIPEGPPAVAN
Download sequence
Identical sequences H3ANC9
ENSLACP00000011150 ENSLACP00000011150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]