SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012039 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000012039
Domain Number 1 Region: 145-242
Classification Level Classification E-value
Superfamily TAFH domain-like 4.45e-35
Family TAFH domain-like 0.000021
Further Details:      
 
Domain Number 2 Region: 530-578
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000102
Family TBP-associated factors, TAFs 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012039   Gene: ENSLACG00000010597   Transcript: ENSLACT00000012130
Sequence length 688
Comment pep:known_by_projection scaffold:LatCha1:JH127773.1:517394:573925:-1 gene:ENSLACG00000010597 transcript:ENSLACT00000012130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVTSDGGQLMLVSQQALARVQAQVQASGAPRSTAPTTTQTIRISMAQTPGAQIVTKPV
TATSGKAPSQPVCTATVPRPAVVKSAPTVRLVTPATPASVVSQKKIVPTTTKTAATAVEG
ARILTTTTTTTATSTAKPSSSLETLENVKKCKNFFATLIKLASGGTQSPEMAKNVTDLVK
NLLDSKIEAEEFTNKLYTELKSSPQPYLVPFLKRSLPALRQLMPNAQTFIQQCIQQQPRS
QPAGAPSASGPGLGTPQQLVKVTSGPLAAISKPPTQTTVITQPAKVGQNAKPVPLVIQHP
PAAAVKQVVTAVPQTSALTVSRPVTSTAVAVTARVQPTAVPASKQSQDEAASALIGLLQI
DEATNPLGCLPSIPAVLTPSSSPFWKVIVFAILCASLAEAGINVKDVGEVRASGAQSIRG
GLGIQAVVRKMSESLYLQASTSMVPQSDFMQFHHLLYVGLFGGGIVVLQASPVQKTPIKE
NGVPSFREEDDINDVASMAGVNLSEENARILATNSELVGSVIRSCKDEPFLFTGPLQKKI
LEIGKKHNITELSSDAVNFISHAAQERLRGLLEKLTVIAQHRAVSYKDDGRYVLADDTRS
QLKFLEQLDRIEKQKKEEEEREVLLKAAKSRTNKEDPEQMRLKQKAKEMQQLELAQIQQR
DANLTALAAIGPRKKRPLDSLLLGNGAE
Download sequence
Identical sequences H3AQW8
ENSLACP00000012039 ENSLACP00000012039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]