SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012209 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000012209
Domain Number 1 Region: 1512-1725
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000085
Family Tropomyosin 0.0038
Further Details:      
 
Domain Number 2 Region: 1709-1920
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000222
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012209   Gene: ENSLACG00000010745   Transcript: ENSLACT00000012301
Sequence length 2003
Comment pep:known_by_projection scaffold:LatCha1:JH126924.1:530635:663248:1 gene:ENSLACG00000010745 transcript:ENSLACT00000012301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLEDTVLNPETSGEDKNLTLPGEGGGATSLPARIRQIVTENLTEVEQKVHCPNPSQEVTS
LASAQEENQVLQLELSRVEDLLFQTRAERDELIIRHRAVSERLEKALKVEAAERDQEATL
SELKQRFEEEEKSYKRKLQAYQDGQQRQGQLVQKLQTKVLQYKKRCGELEQQLLEKTSES
EQQKLLEHEHSADLENALIKLEEEQQSNRTASLTQVNTLLREQLAQTKAANQKLDEEARQ
TTADFNRTRDELEQQEAWWQKEQETYSTYLSNEHSRILTLWRQVAALRSNFNELRTAAGR
DLAEVKTDVTRTTRRLQTACLNLDSNLRLSHANAASSLEKQALQSARLETQLREKVKEMI
QLQSKWDTEKVELNSRISELTVRIERLQAQNAEKEKSLGLLKQNLLKLDMKVAAIKGEGF
MALQTGFLFLALADVDCDRPSPSEGAEDDPGRAAPPLRSVSPQLRSSPPRRQMSPTRAHF
PLQSLSSPLRDSALQAVQSALQRRQLQVQELKAKLEVSLEAASSLKKQLGECESERRMME
QKVVQLKKESEELGQVAEDSKREASRYRSSLEATGSEKDKLEKLLHSLNQQVDSLQLDTE
RLKTVNSDLQRQRAHLEDQKEDLSKDRERARKEIERGQKALEQLEVKNSSLKKELVTVKE
ALSAAVLEKEVLDSETAGLVESLSKAEAANGELELSMNKLRTEEATLRDSLAKMSSLNEG
LAQDKIELNRLLLQMEDEKAALAGQKRDVELERSNLREELSRLEQEKADLSTERRKLEQS
LRAAEESREIGEETSILLRREKAQLQEQATQVGRGYIPGKGVEGTAAGIWNREREREVCV
CVCVFRERETLFEPCSWEVDCGSFKAAEFENSLHLCFRAEKESLETSLFETQQLVRQLEA
RQEQLEGENQSILLAKEALLVSLPPAENERALRELEVHLASLERDKEQLEQRLSQVESEA
QLSMRNQQLAHEEDVERLQKEKESLRLELTSDKQKVMYHLQQEREELIAAHEGEKEELKE
EIVALQQERDESLILAENDKQQALSLKESEKNSLAERLGQAQRELASVHMEIERLKREAQ
GRQDQDKNTICSVTAELKNFRARFEDAVHTHEREVKNLNEQLRDLGRQRETALREAEELK
TLLRLAEDSRDGVRRDLIEAHRKIREGEEGWELQRKEILELKRALGDEVREKEAIQNSNA
ELRNSIKKTESERSSLKRSNEEKDQKICILEESRTSAQKEATELRSSLRDVEKSRLEVRR
ELQELRRQVKTLDAENTKKGKELSELQAQVVQDEQREEESRRESLGLRQKIVETEAGRET
ACKEVANLQRKVAELETELRVRERDSTEQLEQCICNKKKLQDDLHNLETKLGSASAEATE
TKAQLHSAEERIRSLDSELSKAQAAKREAEFRLASLYSALRRTLGIGRTGRAQSPEARAR
SPSPRRPLSPTKGFDPKPSTDNFSIPNPRSSSPGRSRSSSPYHTQSPSHSELALTDIDPE
VVRTALRDFLLELREAQRDRDEAQIHMLNLSRQLAEVESNQDRMNVRIQHLQKSLTETEE
GKRGADGRLSSAQTALMLQEEMIRRGERERKALAEQVAALERSAQTGEGEKRALQEKLNK
MKANEGKLETDKRKLKEVLEVSESRATKLELARRSLEGELQRVQLAVNDRETEIRELQDR
VGALQCQAGDGEDKAASLRLLAERLSVALAKAEEGESQAKDKVQSLAAALSDTTTGAATA
QERISQLQKALVASEQDRRVLQERLDSTREALSDAKRQIHGLTEKMQLIQRQQEAVELQC
MESEGRARQLQEVLRQHQVGEAELAKTVQTLQEDKQLLHEKAAGLQRTLSQLEAEKKEME
RYTVQLEKDKSALKKTLEKVEREKMKKEEDAMRLCAEKGQLDQSLGSLEKELSETQRQVH
QLQAQVSEMERSHTQRLLELTTRHRQEIELEVERLHSTQTQAERTLEGRERAHRQRVKGL
EEQVSTLKDQLDQEMRRRQAYIS
Download sequence
Identical sequences H3ARD8
ENSLACP00000012209 ENSLACP00000012209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]