SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015235 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015235
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.45e-43
Family Calponin-homology domain, CH-domain 0.00077
Further Details:      
 
Domain Number 2 Region: 922-1032
Classification Level Classification E-value
Superfamily E set domains 1.72e-36
Family Filamin repeat (rod domain) 0.0000015
Further Details:      
 
Domain Number 3 Region: 1210-1322
Classification Level Classification E-value
Superfamily E set domains 8.01e-35
Family Filamin repeat (rod domain) 0.00000842
Further Details:      
 
Domain Number 4 Region: 1324-1433
Classification Level Classification E-value
Superfamily E set domains 4.07e-34
Family Filamin repeat (rod domain) 0.0000151
Further Details:      
 
Domain Number 5 Region: 1399-1516
Classification Level Classification E-value
Superfamily E set domains 3.4e-33
Family Filamin repeat (rod domain) 0.0000155
Further Details:      
 
Domain Number 6 Region: 334-452
Classification Level Classification E-value
Superfamily E set domains 1.07e-30
Family Filamin repeat (rod domain) 0.0008
Further Details:      
 
Domain Number 7 Region: 548-656
Classification Level Classification E-value
Superfamily E set domains 3.12e-30
Family Filamin repeat (rod domain) 0.00038
Further Details:      
 
Domain Number 8 Region: 1121-1231
Classification Level Classification E-value
Superfamily E set domains 8.01e-30
Family Filamin repeat (rod domain) 0.0000132
Further Details:      
 
Domain Number 9 Region: 728-848
Classification Level Classification E-value
Superfamily E set domains 2.14e-28
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 10 Region: 1916-2014
Classification Level Classification E-value
Superfamily E set domains 4.94e-28
Family Filamin repeat (rod domain) 0.00000953
Further Details:      
 
Domain Number 11 Region: 1035-1144
Classification Level Classification E-value
Superfamily E set domains 1.27e-27
Family Filamin repeat (rod domain) 0.0000192
Further Details:      
 
Domain Number 12 Region: 2191-2287
Classification Level Classification E-value
Superfamily E set domains 4.54e-27
Family Filamin repeat (rod domain) 0.00000787
Further Details:      
 
Domain Number 13 Region: 157-270
Classification Level Classification E-value
Superfamily E set domains 4.27e-26
Family Filamin repeat (rod domain) 0.00079
Further Details:      
 
Domain Number 14 Region: 1738-1828
Classification Level Classification E-value
Superfamily E set domains 1e-25
Family Filamin repeat (rod domain) 0.0000178
Further Details:      
 
Domain Number 15 Region: 441-543
Classification Level Classification E-value
Superfamily E set domains 2.07e-25
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 16 Region: 1507-1621
Classification Level Classification E-value
Superfamily E set domains 2.87e-25
Family Filamin repeat (rod domain) 0.0000118
Further Details:      
 
Domain Number 17 Region: 2385-2477
Classification Level Classification E-value
Superfamily E set domains 3.54e-24
Family Filamin repeat (rod domain) 0.0000116
Further Details:      
 
Domain Number 18 Region: 2514-2604
Classification Level Classification E-value
Superfamily E set domains 1e-23
Family Filamin repeat (rod domain) 0.0000173
Further Details:      
 
Domain Number 19 Region: 646-749
Classification Level Classification E-value
Superfamily E set domains 4.9e-23
Family Filamin repeat (rod domain) 0.00059
Further Details:      
 
Domain Number 20 Region: 2292-2382
Classification Level Classification E-value
Superfamily E set domains 5.54e-23
Family Filamin repeat (rod domain) 0.0000156
Further Details:      
 
Domain Number 21 Region: 2127-2208
Classification Level Classification E-value
Superfamily E set domains 2.14e-20
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 22 Region: 256-351
Classification Level Classification E-value
Superfamily E set domains 3.15e-19
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 23 Region: 836-939
Classification Level Classification E-value
Superfamily E set domains 2.74e-18
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Domain Number 24 Region: 1838-1933
Classification Level Classification E-value
Superfamily E set domains 7.34e-18
Family Filamin repeat (rod domain) 0.0000211
Further Details:      
 
Domain Number 25 Region: 1675-1750
Classification Level Classification E-value
Superfamily E set domains 4.07e-16
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015235   Gene: ENSLACG00000013413   Transcript: ENSLACT00000015341
Sequence length 2605
Comment pep:known_by_projection scaffold:LatCha1:JH126971.1:856252:947422:-1 gene:ENSLACG00000013413 transcript:ENSLACT00000015341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEDEDDAKKQTPKQRLLGWIQNKIPY
LPITNFSQNWQDGKALGALVDSCAPGLCPDWESWDPHKPVDNAREAMQQADDWLGVPQVI
APEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGPGIEPNGNVVMRPA
VFTVETISAGQGEVLVFIEDPEGAREEAKATPNNDKNKTYSVVYVPKVAGSHKVVVLFAG
QHISKSPFEVNIDKAKGDASKVTAKGPGLEATGNIANKSTYFDIYTAGAGVGGVGVMIVD
PQGNNTVEAVTENKGNSVYRCTYKPVHAGPHTVNVTFAGASIPKSPHTVVIGEACNPNAC
RATGRGLQPKGMRIRQVADFKVDTKAAGSGDLKVFIKGPKGLEEPVKQKDFLDGIYAFEY
YPVTPGKHVVTITWGGQNIPKSPFEVQVGPEAGPQKIRAWGPGLEGGGVGKSADFVVQSI
GTEVGILGFAIEGPSQAKIECDDKNDGSCDVRYWPTEPGDYAVHVMCDEEDIKDSPFMAT
IQPASTGFNPEKVKAYGPGLEKTGCIVSKPALFTVDTKDAGNALPKVYAQDAEGKPVNVQ
MKNKGDGTYTCSYTPVKPIKHTVAVAWGGVNVPNSPFRVNIGQGSHPQKVKVFGPGVGRT
GLKANEPAHFSVDCTEAGDGDVSVGIKCDARVISDKEEDIDFDIIPNSDDTFTVKYTPPG
SGRYTIKVLFAGEEIPISPFRVRVDPSHDASKVKAEGPGLSNAGVECGKPTHFNVFTKGA
GKAPIDVQFSGPGKGNLVKDFEIIDNYDFSHTIKYTPMEQGNMRLSVTYGGDPVPKSPFN
VGVAAPLDLSKIEVNGLASRVEVGKDQEFTVNTKGAGGQGKLDVNISSPARKAVPCVIEP
VMGKDSNVAKYIPKEEGLYMVDVTYDGHPVQGSPFTVDAMLPPDPSKVKAYGPGLKGGFV
GKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPAEAGEYLVNILFEE
THIPGSPFKADIQLPLDPSKVVASGPGLERGKVGEAGLLNVDCTRAGTGKLAMEAVSDTG
SKAEVDVQDNKDGTYAVTYVPHLPGIHTLLLKYGGQTVPKFPVKVKVDPAVDTSKVNVYG
PGVERKGVFREATTNFSVDAGSLTKVGGNHLKTQITNPSGESTDSLIKDNNNGTYSVEYT
PFENGTHLVEVTYDDMPVPKSPFRVDVTEGCDPSRVHANGSGLQEGLTDKPNAFAVVTRG
AGIGGLGITIEGPSESKMSCKDNKDGSCSVEYVPYAPGDYDVNITYGGQHIPGSPFRVPV
KDVVDPTKVKVSGPGLGTGVRSNIPQYFTVDCSKAGVAPLKVQVQGPKGIVEPVEVVDNG
DGTHTVAYTPTLEGPYSVSVKYADEEISRSPFRVKVLPTHDASKVKASGPGLNTSGIQAS
LPVEFTIDAKDAGEGNLSVQITDQEGKPKKAKIHDNKDGTYTASYIPDKTGRYTIVVKYG
GDEIPYSPYRIRAAAAGDASKCTATGLLIGYGLGPGIAPTVQMGNEQGFVVDAKAAGKGK
VNCTVVTPDGTEVEADVIENEDGTYDIFYTAPKPGTYYIYVRFGGVEIPHSPFMVMATDE
VPVMEQQLVQQQQTLNAAYPPGFQPWVTGDAYAPNNEIDGMGFRPFDMVFPLAFRKGEIT
GEVHMPSGKTATPEIMDNNDGTVTVRYSPTEAGLHEMHIKYNGSHIPESPLQFYVNYASS
GSVTAYGPGLICGIANKPATFTIVTEDAGEEGGLDLAIEGPSKAEINCIDNKDGTCTVTY
LPTLPGDYSILVKYNEKHIPGSPFTARITVDDKKRRSQVKLGSAADFLLDINEPDLSLLT
ASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGHHLPNSPITIMVVQSEI
GDASKVKVSGQGLMEGSTFEMSDFIVDTRDAGYGGLSLAVEGPSKVDIQTEDIEDGTCKV
SYCPTEPGVYIVSIKFADEHVPGSPFTAKVTGEGRVKESITRKRRAASVATVGSICDLNL
KIPVTWFQMAISRENLSHFPYQSNFVFLCAERMEFHRAPFGQSRCRLFVGRPASVRSQLL
PFVFDLWCREERELFSARPLGPEALEIDIRDMSAQVTSPSRRTDDAEIVEVGNNTYCVRF
IPNEMGIHTVCVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIW
THEAGAGGLSIAVEGPSKAEISFDDRKDGSCGVSYIAQEPGDYEVSIKFNDDHIPESPFL
VPVTAPSDDARRLTVTSLQESGLKINHPASFAVKLNGAKGKIDAKVHSPSGAVEECHVSE
LEPDKYAIRFIPRENGVHSINVKFNESHIPGSPFKIRVGEPGQEGDPGLVAAYGSGLEKG
TTGTQAEFTINTMKAGPGALSVTVEGPSKVKMDCQECPEGYKVMYTPMAPGNYLIGVKYG
GPSHIIGSPFKAKITGPRLVSGSSTNETSSLLVESVTRSATMNSYSAVPKFSSDASKVVS
KGAGLSKAFVGQKSNFSVDCSKAGTNMLLVGVQGAATPCEEVSIKHMGNKQYTVTYVVKE
KGEYVLAVKWGEEHIPGSPFRITVP
Download sequence
Identical sequences H3B014
ENSLACP00000015235 ENSLACP00000015235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]