SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015287 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015287
Domain Number 1 Region: 621-1048
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.69e-105
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000238
Further Details:      
 
Domain Number 2 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.92e-76
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000013
Further Details:      
 
Domain Number 3 Region: 290-620
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 8.37e-76
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000187
Further Details:      
 
Domain Number 4 Region: 1358-1522
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000000000000133
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015287   Gene: ENSLACG00000013456   Transcript: ENSLACT00000015393
Sequence length 1826
Comment pep:known_by_projection scaffold:LatCha1:JH127047.1:860839:946661:-1 gene:ENSLACG00000013456 transcript:ENSLACT00000015393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGIILALTFALVTDPKFSLEPNFKKSNTYLYSYQGQVLTGLPEKGLARGGLKLNCKVEI
SGVGQRFLLTVRDLQIEEYNGIWPKDSFTKAPKLTQTLTAQLTRPITFDYKNGRVGNIYA
PPDVSDMVVNIHRGILNMLQVTIKEKENVYNVQETGIEGVCESNYIIQEDKKANKVVVSK
TRNLNNCEDKAIQILGVYLGDKCANCEQRNKNVQEAATYSYMIERTRAGSTILVKVDAQE
FHLVTPFSMKDGAATTETRQKLSLIDVKEELINTPQVQMQNRGTLHYRFSSELQQMPMQL
IKTKNPAIQIIELLRQHNQQKIHEGIPKKFLHLVQLFRAASYENIEEVWKQITKIPHHRH
WVLDIIPAIGDPKALRFLRHRGESGDLTEFELSLALVSLLPTCRADHQDINEVKKILMNS
RAQRKPFLHKTALLVYGTLIKKHCKEKPCPENALQPLYELAAEAVSKGHEEEMVFALKAL
GNAGQPASIKRIQKFLPGFAGGASKLPIRVQVDAVMALRNIAKKEPKKVQDIIVQIFMNN
NLHPEVRMMAFLVLFETKPCVALLTNIANALLKENNLQVSSFAYSYMKALTRSTDPEFFT
VATACNVVVKLLNPKFDRLSYRYSKAFHFEVFKESLMIGAAMDFFVINNAASIIPTAFIS
KIKADALGISDEIFEFGIRAEGLLEVLDMKNHGHARETPSTDKIQKILKLLHNWKELPPE
KPLVSAYVKIFGQEMAFAELNKEAIQQSVEAITGPGEKHITVKKIIDLLQNGLTAQWSNY
LLLTEVRRIVPTSIGLPVEASFYDVYAANHKINVEARISPTPTSDFRIAQLVNANIQLTV
KVNPSMVMEQFVAVGINTPLIQTGIEARVRGESTFPVNFAATINLKEQNLKIETPPCQQI
TEIVMHRSKSYAVTRNDDDQKAEKITLLLPPAAAASIIDQHFNSGEKGSEESTATAEKMS
SEMLSQDATFPAEQAGTRGVSRSRAYHVCATATSFGIQICMEKNSADADFLRNSPLYVLI
GEHEVQIKVKPVHTEPAIEKIKIEIQAGPQAAAKMINLVKAGEVHEDDLGTAKPEDKNVL
KRLKKIFEAEEKPRHYVSELWKKKDSEVTKLADERNYKDPHTGTSSSICLTGTIYPNGKS
SQHEISVNNDFEKGAAENQNAEMNMESSKKQGLNRREKSSSASSWSRSSSISGSSSQKSQ
RRHSQSTSLSSSRSSSLQEQAEEQAARVHSREKVKNGQRKSNSRSRSRSRSSSSSSSSSK
SHERKRHASHQAKQQSKDTWSTSSSVSRSSSSRSSYSQQKSDNLQIYRLQFQPYQQSSVH
EHDNRKPSSSSSSSSSSSSASTIESAQQSRFLGDRMPLVLTVLARTIRIDKKQWGYQATV
YVEKSSLKYKMQLITVQLDEKSKWKACADTEMTKAYKAASYVALGKNKQRALAQNELTTD
MYSMMAIRNKHPQPEIWRKISTLVIQWGYNVPKVIFVCLGFFFLGDKHFLHIPLTFNLKS
SFKTCQSSKLTIYKEAVPLPVSIPLTGSVDESAVSGSQQHAVFSILKEVSEMMTNAVREE
CTIARRTFRMFDHVKFKYSMPESCYHILVQDCRKEPKFMVQMKVIKRRKIISAVLASDEV
QIELYDGAFRLLHNGHFIPQDQEHHNSSAGTFSVTRLFNGYLIQAPDLGLQKLQFLKELV
KIVVGPKMKGKTCGICGHGDGEKTQAFKMPSGKVAKSPTSFAQSWLLREETCPANCKLTR
KCVELGKTVRFEGKDSKCYSTEPVLRCLPECSPTKMITVKVGFHCVPSDSALSLDHHMDF
DQQSEDIVDTVESHVACSCEDKCYST
Download sequence
Identical sequences H3B066
ENSLACP00000015287 ENSLACP00000015287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]