SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015429 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015429
Domain Number 1 Region: 248-348
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-27
Family Ras-binding domain, RBD 0.00000441
Further Details:      
 
Domain Number 2 Region: 1001-1097
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-23
Family PDZ domain 0.0000312
Further Details:      
 
Domain Number 3 Region: 38-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-22
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 4 Region: 404-503
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.26e-22
Family FHA domain 0.00000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015429   Gene: ENSLACG00000013584   Transcript: ENSLACT00000015535
Sequence length 1854
Comment pep:known_by_projection scaffold:LatCha1:JH126956.1:880367:1260722:1 gene:ENSLACG00000013584 transcript:ENSLACT00000015535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKVAGNFATKCIR
VSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGEERKLDPEEKPLVVQLNWNKD
DREGRFVLKNENDLIALKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRREKEALLRQ
ATDGDDRSLQRDDGENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFYS
GDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTTDFAVAEALEKYGLEKENPKDYCIAR
VVLPPGVQNSDDKGAKETVLEDDDCPLQILREWPSDIGTLVFQLKRRPSDYAPKKTKKPV
DGKSSKGKERADGSGYGSSLPPEKLPYLVELSPGRRNHFAYYNYHQNEDGSDSRDKPKLY
RLQLSVTEVGTEKADENSIQLFGPGIQPHHCDLTNMDGVVSVTPRSFDAETFVDGQRISE
TTMLQSGMTVQFGSSHVFKFVDPTQDHLMSKRTMDAGPMIKGPKHKPGGVPETTFDLDGD
IHSGTALPTSKSSNRLDGDRTASISSATERNMVKPMIRVDQQQDYRRQEGRPQEAQGPEL
TLPASIEFRESSEDAFLSAVINYTNSSTVHFKLSPTYVLYMTCRYVLSSQYRPDMSPAER
THKVIAIVNKMVNMMENVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVL
AHLVQMAFKYLVHCLQSDLNNYMPAFLDDPEEQNPQRHKIEEVLHTLTGAMSLLRRCRVN
AALTIQLFSQLFHFINMWLFNRLVTEPGSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAA
DCHLSRIVQATTLLTMDKYSAEDIPNINNTCFKLNSLQLQALLQNYHCAPDEPYIPPELI
ENVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRSIPNGFQEFLEPL
CQRGYCRLIPHPRSPGTWTIYFEGADYESMLLNENTELAQPLRKDPEIITVTLKKQNGMG
LSIVAAKGAGQEKLGIYIKSVVKGGAADLDGRLAAGDQLLSVDGRSLVGLSQERAAELMT
RTGSVVTLEVAKQGAIYHGLATLLNQPSPMMQRASDRRGSGKPRPKSEGFELYNNSAQNG
SPDSPPLPWNEYSEPKKLPGDERLMKNRADHRSSPNVANQPHSPGGKAVYTGGHTSKITS
VSTGNLCTEEQLPPSRPEAYPIPTQTYTREYFTFPASKSQDRLGPVPGQWQSYDDRPPVQ
AEDHHLSSAVVQRATRSQEELRDDKVFQPERIRQEALIHRDTEYQRELDRKQEFSDTWTN
QSSSVESSTSSQEQLNHSNRSIPTSSSNRTGPGRWKTPATTQAAPPVAVSQPIRTDLPPP
PPPPPVNYTADFDNMEPDFPMPPPPPPSQLAPQVPPQAAALDRKKREEQQRWYEKEKARL
EEERERKRREQERKLGQMRNQQVIPPQPMPPVPAGLQTRPEKPVTLTRPQETVIRELQPQ
QQPRTIERRDLQYITISKEELSSSDSLSPDPWKRDAKEKLEKQQQLHIVDMLSKEIHDLQ
NKPDRTAEENDRLRKLMLEWQFQKRLQESKENDDDDDDDDDDEVDTMLIMQRLEAERRAR
QTALPAISVLDLLQDEERRRQQHLEDIRKREAEDRARQEEERRRREEERSRKEAEEKRRQ
EEEYYARLEAERRRQHEEAERMLLQPEEPGLYRPPLPRDYELPPPPPSSNAPPPPPQRNT
SYLKTQVVSPDTVYTAKFVACNDEEEDSNLAGQGFNAYPSSAGGIVGAHEVYRDPRDKRV
KRSGQDVDATTTQGAPENLTFKERQRLFSQGQDVSNKVKASRKLMELENELNTK
Download sequence
Identical sequences H3B0K8
ENSLACP00000015429 ENSLACP00000015429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]