SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015441 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015441
Domain Number 1 Region: 143-403
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-87
Family Eukaryotic proteases 0.000000327
Further Details:      
 
Domain Number 2 Region: 52-154
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000497
Family Hepsin, N-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015441   Gene: ENSLACG00000013595   Transcript: ENSLACT00000015547
Sequence length 415
Comment pep:known_by_projection scaffold:LatCha1:JH127066.1:882410:896425:1 gene:ENSLACG00000013595 transcript:ENSLACT00000015547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSFTFSGGPQSCLTTPKIIAVTILTLAVLGGIAVAIWAILTYVVNINSTALYDVQISSAD
SRLLVYDRSEKVWRMVCESNLNLVLATMSCQAMGFVSSTSSRPLHLRSSASGSHFDLTSP
QILDHARSLTLMSDVIECPSGRVLAVQCQDCGRRKVPVDRIVGGHDASLGKWPWQVSLRY
DHTHLCGGSIISDQWVVTAAHCFPERNRVVNRWLVHTGTISQSSQTGRSLAVKTIIYHSG
YQPLADAYVEDNSNDIAIMQLSSPIAFTDTIQPVCLPAIGQELVDGKECSVTGWGNTKYY
GQQSDVLQEATVPIISDSTCNSPDYYGNQITSKMFCAGYLEGGVDACQGDSGGPFVCDDI
ISKTSRWRLCGVVSWGTGCALAKRPGVYTKVNEYQRWIYKAMKTHASSTGVFTMG
Download sequence
Identical sequences H3B0M0
ENSLACP00000015441 ENSLACP00000015441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]