SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015702 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015702
Domain Number 1 Region: 492-657
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.27e-71
Family A middle domain of Talin 1 0.000000268
Further Details:      
 
Domain Number 2 Region: 662-786
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.62e-52
Family I/LWEQ domain 0.0000035
Further Details:      
 
Domain Number 3 Region: 1226-1362
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.57e-42
Family VBS domain 0.023
Further Details:      
 
Domain Number 4 Region: 1839-1961
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 7.46e-42
Family VBS domain 0.0000114
Further Details:      
 
Domain Number 5 Region: 1073-1208
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.2e-26
Family VBS domain 0.012
Further Details:      
 
Domain Number 6 Region: 215-312
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-25
Family Second domain of FERM 0.00000698
Further Details:      
 
Domain Number 7 Region: 313-403
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-24
Family Third domain of FERM 0.0000178
Further Details:      
 
Domain Number 8 Region: 756-887
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.75e-23
Family I/LWEQ domain 0.0000517
Further Details:      
 
Domain Number 9 Region: 1471-1556
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000183
Family I/LWEQ domain 0.0087
Further Details:      
 
Domain Number 10 Region: 1695-1815
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000251
Family VBS domain 0.026
Further Details:      
 
Domain Number 11 Region: 82-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000202
Family Ubiquitin-related 0.076
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000015702
Domain Number - Region: 1585-1660
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000204
Family VBS domain 0.043
Further Details:      
 
Domain Number - Region: 942-1040
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000667
Family I/LWEQ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015702   Gene: ENSLACG00000013827   Transcript: ENSLACT00000015812
Sequence length 1962
Comment pep:known_by_projection scaffold:LatCha1:JH126577.1:915839:1179222:-1 gene:ENSLACG00000013827 transcript:ENSLACT00000015812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMVALSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVPEAQTGQASDYGLFLSDDDPR
KGIWLESGRTLDYYMLRNGDILEYKKKQRPQKVRMLDGAVKTIMVDDSKTVGELLVTICS
RIGITNYEEYSLIQESTEEKKEDGTATLKKDRTLLRDERKMEKLKAKLHTDDDFFFLGHT
RIYKNQYINKKRPLHLRSFGIQKQQKVNWHAPFSIQCFFLFARDDILNGSHPVSFEKACE
FGGHQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMSEIEAKV
KYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVLRVDEKTKEVMQEWPLTTV
KRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLDGDEE
STMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVM
IGQMHRGHMPPLTSAQQALMGTINTSMQAVQQAQADLNEIDSLPPLGQDMASRVWIQNKV
DESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAA
LMDDEVRSGQDLLRAARTLAGAVSDLLKAVEPASGEPRQTVLTAAGSIGQASGELLRQIG
ENETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQL
VACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVKACQAATDDGELLKQVSAAASVVSQ
ALNDLLQHVRQFASRGEPIGRYDQATDTIMNVTESIFSSMGDAGKPSSSQALNTVAGNSK
FVKVKKKKKNAFFNWGKKLDFSLSKLNADFLCHQGAAANPDNEDQQQRLREAAEGLRVAT
NAAAQNAIKKKLVNRLEAAAKQTAAAATQTIAASQNAAASNKNTAAHQQLVQSCKAIADH
IPQLVQGVRGSQSQPEDLSAQLALIIASQNFLQPGSKMVASAKAAVPTVADQAAAMQLSQ
CAKNLATSLAELRSSTQKAHEACGPMEIDSALTSVQTLKNELQDAKMAAAEGQLKPLPGE
TLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTDFQGVAARETAQALKTLAQAARGVA
ASSNDPQAVNSMLDSARDVMEGSAMLIQEAKQALVLPGDADSQQRLAQVAKAVSHSLNNC
VNCLPGQKDVDMALKSIGESSKRLLVDSLPPSTKSFQEAQSELNQAAADLNQSAGDVVHS
SRGTSRELAAASGKFSEDFDEFLDAGIEMAGQAQTKDDQLQVIGNLKNISMASSKLLLAA
KSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLEN
PNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPVFGECVGVASKALCGLTEA
AAQASYLVGVSDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPASSPSQVLSAATIVA
KHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRDKCR
AATYPLIEAVENLTAFASNPEFVSIPAQISSEGSRAQEPILTAARTMLESSGSLIKTARS
LAINPKDPPTWSILAGHSRIVSDSIKSLITSIRDKAPGQRECDSSIDSINRCIRDIEQAS
LAAVSQNLPTRDDISLEALQEQLTSSVQEIGHLIDPVTTAARGEAAQLGHKVSQLASYFE
PLILAAVGLASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAAHTHDAIAEAA
QLMKEAVDDIMVTLNEAASEVGMVSGMVGSIAEAMSKLDEGTPPEPEGSYVDYQTTMVKY
SKAIAVTAQEMMTKSVTNPEELGGLASQVTSDYGQLAVQGRLAAATAEPEEIGFQIKTRV
QELGHGCIFLVQKAGALQISPTDGFTKRELIECARAVTEKVV
Download sequence
Identical sequences H3B1D1
ENSLACP00000015702 ENSLACP00000015702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]