SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016100 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016100
Domain Number 1 Region: 225-357
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-37
Family Third domain of FERM 0.0007
Further Details:      
 
Domain Number 2 Region: 130-227
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-19
Family Second domain of FERM 0.00074
Further Details:      
 
Domain Number 3 Region: 45-127
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-17
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016100   Gene: ENSLACG00000014180   Transcript: ENSLACT00000016211
Sequence length 506
Comment pep:known_by_projection scaffold:LatCha1:JH126631.1:986767:1078113:1 gene:ENSLACG00000014180 transcript:ENSLACT00000016211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSFLRRTLGRRSMRKHAEEKKWRGEAQRAQMHISAAGDAKSIITCRVSLLDGSDVSVDL
PKKAKGQELFDEIMGHLDLIERDYFGLRFMDSAQVPHFIEGIMYVREKRELRIFGPPYCL
HLRVKFYSSEPNNLRDELTRYLFVLQLKQDILSGKLECPFDTLVYLGAYALQGAQIIPGL
LNQILFLHLQGPKVNMYIYEKLREREGQMPSQAEINYLNKAKWLEMYGVDMHVVKARDGN
EYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKHKLTLVVVEDDEQGKEQEHTFVFRL
DHPKACKHLWKCAVEHHSFFRLRGPVQKSGNRPGFIRLGSRFRYSGKTEYQTTKGNKVRN
RTASFERRPSRRYSRRTMRQRNPTPQNKQKHTHTQNNGMANQNSGSQQARNTRPVLPVLT
AVPTSPVPVEIEDLPYSPGGNQLEKKRPTCANDPSLHDGDAWSSVASSPSKAVDGSFTGF
VCERNVKSAGTHGDVSGQGEQKTALV
Download sequence
Identical sequences H3B2H9
ENSLACP00000016100 ENSLACP00000016099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]