SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016414 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016414
Domain Number 1 Region: 8-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-24
Family Ras-binding domain, RBD 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000016414
Domain Number - Region: 238-286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0396
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016414   Gene: ENSLACG00000014461   Transcript: ENSLACT00000016528
Sequence length 443
Comment pep:known_by_projection scaffold:LatCha1:JH127215.1:1033599:1034957:1 gene:ENSLACG00000014461 transcript:ENSLACT00000016528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQEECKISVWLCQEEKLVSGLSRRTTCADVVRVLLGDHNNSHQEGSIGMLSGPPQAYCI
VEKWRGFERILPNKTRILRLWAAWGEEQENVRFVLLKNGASLPNNGPRSAEARVVLSKES
PCKGAARATMALTQEKQRRIVRKAFRKLAKINKKRQEALSKDSSSVEKMETLVHLVLSQD
HTIRQQIQRIKDLDREIDRYEAKIHYDRMKRHGVNYVQDTYLVDASSETECNGDLSKTDH
ALFFAQLEEYAKKCEEVLQFHEQLTQQEDLIEQITVDIQEELNQRWMKRRQEELSENEST
TAEQPAVDSDHQLEKERVKTQLSTSLYIGLRLNTDLETIKNDLDYSQQIWDAKEKELQSL
LENINSLGIEDNDPITEVLDSPRDSPVLKDPEIQSCVDSTDGWVEQARGLSKVCDANDED
SDTGLSSMHSQDSDTIPICESLV
Download sequence
Identical sequences H3B3E3
ENSLACP00000016414 ENSLACP00000016414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]