SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016946 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016946
Domain Number 1 Region: 628-1043
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-106
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000138
Further Details:      
 
Domain Number 2 Region: 298-626
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.83e-80
Family Lipovitellin-phosvitin complex, superhelical domain 0.0000000701
Further Details:      
 
Domain Number 3 Region: 24-274
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.89e-79
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000879
Further Details:      
 
Domain Number 4 Region: 1281-1451
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 6.67e-52
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016946   Gene: ENSLACG00000014924   Transcript: ENSLACT00000017066
Sequence length 1753
Comment pep:novel scaffold:LatCha1:JH126745.1:1129601:1196643:1 gene:ENSLACG00000014924 transcript:ENSLACT00000017066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLILALTLALVGSEKTHYDPVFQEGKTYIYDYEGLILTGLPENGLSRSGLKVNSKVKI
REYAQRRFILKVDDLQVKEYNGYWPQDAFIKASKLTQALAVELTKPITFEYSSGRVGNIY
APEDVSDAALNIHRGVLNMLQINIKKTQNIYDLQEVGVQGTCQTTYEIQENKKANRILIT
KTKDLNNCEEKLMKTFGMTYAESCGNCQQQNKNMRGAASYSYKLKKIDTGTLILQISTQE
LHQFTPFSEKTSPAIMEASMKLVLLVTQQRCIRPILWQIYEKQYEIKFCVLSRNLSDFFF
LHIFKVKRKSPNIVQTLDHLVRNNQQEVQPDAPLKFLQLVQLLRVATHENLEAIWKQYSK
QPQYRRWFLDAIPTIATSQALKFFKEKIQSTELTQNEIMLALVTTMQLMNANHNAMLTAA
DLISMSHIRRTPILRKAALLSYGSMVYRYCVTIPVCSDSVLQPLHAFAADALSRHHEEEM
TLALKALGNAGHPASIKMIQKFLSGFTARAVDVSLTVQADAMMALRNIAKKEPRKVQDIA
LQIFLGCNFHPELRMLACMILFETKPNMGLVTVMADALLKETNLQVASFSYSHMKALARS
TAPDLLRVASSCNVAVKLLSPRLDRLSYRYSKVLHVSKVNYNLMAGAIADVFIINNRVSI
LPTAVIAKIRGYFLGAAADVLEVGVHAENLVEAIKRSRLPSSEDSDMLKIRQIMKLLHDW
KALPAEKPFASVYVKLLGQEVAYTELNKKLLDQLIKVVREPGERHVTVKKIVSQLESGVN
THLSKSLLASEIRRIVPTCVGFPMELSLYSVAVGAANVNRIVQVQFSPPPSSTFNLNQLF
NSKMEVKAQVSPSQVTDTIGVMGINTHIVQSSMEVHAKVCNTAPVKFTAQIDWKEKHLKI
ETAPSEQDNKLLFVRTETYAASRNIEDLAASKTTPLLPLGTEADILKVHFKPAKAVSTES
RQAIVRFSTKHTSPKLEPRMYHGCAKATKFGFQVCLDASARNAAFLKNSPLYVLVGNYFT
GVDLKPVRTEATIEQLQLEIQAGVNAASKIIRLNAKQGSKEDTSENREPPGTILQKIEKF
LWAVGQDDFRNQSFRSSSWSSSSSIQAADNRGDSFENVRQKLGHSKGKNKAQKHSKYSSS
SSSKTRSSSSSSSSEVEKNSHHQKQQSHSKQQSARHRSIHSTSSSSSSSSRRRSSSQSGR
RSAHQQIHNPKKDDWRITSSVSSRSSSSSSGSNSKSSNSGSRRQHKPKGSSSSSSSSSSS
GSGTRSTESYQQPKFLGDMFPPVLAVIACAIRSDGKRQGYQIATYTDASLPRPKVQILVM
ELEAGSRWRICADAAVLSPYKAKAELKWGQECQDYKVALKTEIGRFAIYPAVQIKMSWDN
VPRPIKDRVKAFDEYVPGAAYMLGFTEKWQKNPSHQLVVILTSTSPRIIDIVIRAAPLTL
YYQGFEIPFAIPTLGAKSAVALQRTEWSILSQLPGSTIADACTINGDNVQTFDHVKFKYN
VPTMCFTIMAQDCTTAPMFAVLLKVVPEYAQRYLTVDLSNRPIDMIPVVGGPLRLIIGDT
EVPLSDLPFIDPEIRFSIIQVKDGLLIKANYFGIEELYFDGKEEISLKITSEMAGKTCGL
CGHSDGEIKQEFRVPSGEVAKDANSFGQSWVMTPDTCNGGKQNECKLQRDYVELGKEVQV
AGQNSKCYSVEPVLQCFEGCSPKTTVPVKVGFHCVPADSAMSKSDYRDLDEKTEDLEDTV
NAHTGCTCTEQCS
Download sequence
Identical sequences H3B4X5
ENSLACP00000016946 ENSLACP00000016946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]