SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017302 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017302
Domain Number 1 Region: 624-1043
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.24e-121
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000822
Further Details:      
 
Domain Number 2 Region: 289-622
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.57e-81
Family Lipovitellin-phosvitin complex, superhelical domain 0.0000000385
Further Details:      
 
Domain Number 3 Region: 23-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.1e-78
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000158
Further Details:      
 
Domain Number 4 Region: 1408-1578
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-54
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017302   Gene: ENSLACG00000015239   Transcript: ENSLACT00000017429
Sequence length 1880
Comment pep:novel scaffold:LatCha1:JH126745.1:1207242:1243699:-1 gene:ENSLACG00000015239 transcript:ENSLACT00000017429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGIILALTLTLVGSQHLSYEPAFDDSKTYVYNYEGVILSGLPEKNLARAGLRIHSRVEI
SGGAQRSCILQIRDPHIEEFNGIWLKDAFTQSPKLTRVLAEDLTKRIKFEYNNGRIGHIE
APADMSETAVNIIRGILNMLQITIKKSQNVYEIQEAGLGGICQTNYVIQEDKRTNQITVS
KSRDLDNCHEKKMKNIGMSYLQVLSTRQQQEKNMRGAAAYIYMIKPKANGALIDKVTVRE
QHEFTPFNELDDAAVTEARQKLVLVDIRNTPLALPQIQLQSRGTLQYQFATETLQIPIQL
IRTKNPEQEIENILQHLVQNQQTSGSDTPAKFLQLVQILRMITHENVEAIWKQHVRRTEY
RCWLLDAVPAMATPAALKFMKQRIQNHEISHIEAVQALITTMQTVKTDRQALETAAELVS
SERIQKVPILRKTVFLAYGSMVYRYCFPMDSCPETALQPLHDLAVEAVSKAHEEDMVLAL
KSIGNAGQPASVKRIQKFIPGFAPGATDLPVRVQVAAVMALRNMAKKEPRKVQEIALQIF
LNCKLQPEVRMLACVALFESKPSIALVASAANALLKETSLQVASFAYSHMKALTRSTAPD
LKEVAAACNVAINLLNPKLDRLSYRYSRALHADGFRSKWMAGAAVDFFVINSAASILPSS
VVSKIRGYAVGATADILEVGVRAKGLQDVLLKSRESFSGIPSKKKIEDILKKLANWKALP
ADKPLISAYFKLFGQEIGFAEINKEYIQEAFQFGTAPSEKHSKVSKYVRQLQNGIAAQWS
KPLLMAEARRILPTCVGLPMELSLYSAAVSAATINADAQISPPPSADFRLTHLLNANIRL
RAQVTPSVDIHNIVVMGVNTQLIQTGIEVHGKVCMTTPLKFTAKIDMPERSLKLETAPSQ
QETEMVVLRGEVFAVTRNIEELSSARKSLVLSASATNIMRQHFRSAEKASQARLSSEMMS
LEDPYSAEQASRHMAASSADHYACAKAKTFGFELCFLAKTKNAAFIRNSPLYRVFGEHEA
KVILKPDHSSIAIDKIQIEIQTGARAVSKLFRGMETDEMNEDSGEAQGKMVLLQLSLQDL
GKNGTKTHRSSSSSSSSSSSFSSRKHSKKFSSSSNQEPGITREKTDGIENLRARKRHQSR
SSSSSSSITRSKSSSSATLSQRNSEPRLSNEETRKMQPQRENARHSNMDKEAWSHKQRSK
GGRSSSSSSSSSNKSSRSSSSSRRSSRRSSSRSSSSKSSSASRASRYNSERKHHKGSSSL
SRSASSSQSNSRAGSKVKISLGKSHERIQYNLYKQGNEVRSSFNILSKDLINLKKKKKKK
KNLRIYFQKLILHFRSSRRTSSKSSSESSESSESDNDMSKQVGFLIDYHLKNSYSISHSS
EYDMELAVKKKITISVLNNPKFPEGSTPPVLAIVTRAVRSDGKQQGYQIAAYANFRSSKP
RVQVLAMELAKSDRWRVRVDGILLSPHKAMGIIKWGEEGKNYKVVVKAQTGQFAAHPAVQ
VKVDWTDVPRTVKETVRAADKYLPGAAYLAGFSEKWRRNPSHQVAVILASASSRTIDIVV
KLPQMTLYRQAIPVPLPLPGRTIQYPTSQVQPLGWNLITELPKLLTDEATTQCTVEQNTI
KTFNNVTFDYSMLGDCEHILVEDCINMSFLVMIKKAEVSSGDKQLNIKIADFEVVMYPSE
GSIKLQIDGTEIPISSLPYTDPSGKVTIKKTENGNAIILSAESLGINSIYFDDKKCKIEV
SEFLRGTVCGICGRADGERTQEFQMPDGCVAKESVSFVQSWVVPGSSCSGACQLQHDYVK
LEKQVRLHGENSKCYSVDTVLRCRRGCSPVATTPVTVGLHCVPADTTMKWTEGQMNFDQK
SEDITDMVLAHTACSCSDTS
Download sequence
Identical sequences H3B5Y1
ENSLACP00000017302 ENSLACP00000017302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]