SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017445 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017445
Domain Number 1 Region: 772-904,967-1033
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.92e-39
Family Hemopexin-like domain 0.00045
Further Details:      
 
Domain Number 2 Region: 40-80
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000157
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1-37
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000445
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017445   Gene: ENSLACG00000015365   Transcript: ENSLACT00000017573
Sequence length 1033
Comment pep:known_by_projection scaffold:LatCha1:JH126934.1:1243300:1264635:1 gene:ENSLACG00000015365 transcript:ENSLACT00000017573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCSGRCGETFHRTNACHCDYECILHDECCIDYRDTCTTGSSCNGRCNEEFSRGRECDCDP
ECDEYNKCCPDYQQFCKKTSKPNKPTSRTFTMTPGRQSTTVLLNTEVPNTDSNIAEQVLE
LDITSIAVIAEVSTIATSTDEETNTETLIRNNNTQAPSEMNESATSIGFSITDIPVIEEE
GTSGDDFAEDILNNQPTYQLYSENSSVTTEPKEASADSETMEPSVLKDSSTIAEESKTNP
VTLDTEVTEEISVEESSHGKAETEGSKYVSTDSYTSHLASVESSTISPTSSLKENSHTFV
STAEPFTLTEEPKTSPVELTTTGTKNLYRESYTSYLASIASTEVSSTGSPKESTSAFDIT
EEPFASHNETKTNPVIMQTEEIQSISTESYASHLTSVQSSTVSLTSSLKESTPQFISIVE
LSTLSEESKMSPAELATAATKGISGETYTSNLASITTTKTTLTSALEEKNSTLDEFKTSP
VALQTDITKGILEEPNTSNFDPAEGSTINPTLALEKTTLLIGNTVTVEPSTSAGKPKTNS
AELETGAKKDTYAEVYISHLALVASTKVSPTSDLSENTHQKESSTVHSTSSLKETSSLFD
NTVEFSTLTENPETDPATVQAVGTISTFTHSGTKFSTLDKESKVSSVTIEAESKIISTEA
HTTQLSVTSSTKISGREKSTLVTGANVELSTLAEVPKTNPVAQETQATTKGKLTPKSSTN
KFNPENDLSMNPNGSLEKNTILDKRAKEPSILVEKFNESLSTVEIDNPNDTDLCNKRPVD
GITTLQNGTMFVFRGHFFWRLNQYGQAQGYPQRIQDVWGIPSPIDTVFTRCNCEGKTFFF
KGTQYWRFSNSVKDNGYPKPIFRGFAGLTGKITAALSVSAYNTRPESVYFFKQEKGGLAQ
QYTYRQESSKSCQKTNSGLQYSIYIHKKRLTRAARKLKINHVNEVLSSFPTMLTYPWFAG
ILEREISIRTYWKGFPKVIHSAVSVPNPRKPDGHDYFVVSKADRYYNINITTPSTPVASL
SQSTISADWYKCP
Download sequence
Identical sequences H3B6C4
ENSLACP00000017445 ENSLACP00000017445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]