SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017475 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017475
Domain Number 1 Region: 683-893
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000032
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 2 Region: 834-1054
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000053
Family Tropomyosin 0.002
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000017475
Domain Number - Region: 408-597
Classification Level Classification E-value
Superfamily Tropomyosin 0.000418
Family Tropomyosin 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017475   Gene: ENSLACG00000015390   Transcript: ENSLACT00000017603
Sequence length 1181
Comment pep:novel scaffold:LatCha1:JH126865.1:1248872:1294349:1 gene:ENSLACG00000015390 transcript:ENSLACT00000017603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRQRNSLNDELIQAQREIERQCELLVRAAKEKEDLTKDKASLVVQLTASERENRALAEE
GAGLRSEKEALETTLYDIQQQLTQLETRKEQLEGENQIILLAKEALQAEVSRVRKEMEVE
MTKLERDRELLTQKLAHTEQEAQVTLKNEQASHEEDVDHLQREKEGLRLEMEAEREELFH
RLTQEREELVARHEAEKDELSEEITSLQQERDESLLISENEKQQALSLKESEKTILSEKL
SNLQHELASSAMEIERLKRDALNRQEQDRSTINDLTAELKSFREQFEEAVMAHEREVKAL
YEQIKDLGKQREASLREPEVEELKVQLRIAEDARDGIRRDLIEAQRRIRESQESHEIQRK
EILDLKRALSDEVKEKEAVQRSNEELRACIKKTESDRISLKRVVGEREQKLCVLEEAKTI
IEKEVSDLRAGLREVEKSRLEARRELQELRRQVKMLDSENTKKSKEVAELQARVALDEQR
EEESRRESFGLKQKIVETEASRESARKEITNLHRKISEIENEFRVREKDLLSSLEEARGN
EKKLLDNAKNLEIKLDNACGDISELSLKLSAAEGRINGLEAELARVEGMKRDVEFKLGSL
HSALRRTLGISRTGRTHSPAIRGHSYSPQRSRSPPKGNIADMGLSSRPVSPERSFSPTRS
EQFVADIDPEVVRAALRDFLQELRDTQRDRDENRIHVSNLTRQLGEMEADRDGVNLRLQQ
LQKSLAESEEGKRGADGRLSSAQTALMLQEETIRRNERERKGLLDKVATLERSLQSSESD
KRALQEKMNKMKANEAKLENDKRKLKEILDASESRATKLELVRRSLEGELQRMKLVMGDR
ETEIQTLQDRIETLQRQVAESETKANSLKLAVDKVTASLARAEDNEKSLREKVQTLSISL
SESNASTSSFQEKMLQLQKALTASEHDRRILQERLDVARQAVSEAKKQNALLLDRVQVLQ
NEQSELELQQVELEGQIRQNQEMLRQHQESEDAALRNIQKLQEEKQVFQERLSSLQRALA
QLENEKREVERSSVRLEKDKSALKKTLEKVEREKLRSEEDTMRLSAEKGRLDRSLTTVEQ
ELVEAQRQVQQFQAQLVDMEQTHTQSLVEATARHRQELQLETERLRSAQLQAERTLEARE
RAHRQRVKGLEEQISTLKDQLQQELRRRQPHYSHSSILSGN
Download sequence
Identical sequences H3B6F4
ENSLACP00000017475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]