SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017476 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017476
Domain Number 1 Region: 660-868
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000137
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number 2 Region: 814-1025
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000163
Family Tropomyosin 0.002
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000017476
Domain Number - Region: 353-574
Classification Level Classification E-value
Superfamily Tropomyosin 0.000216
Family Tropomyosin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017476   Gene: ENSLACG00000015390   Transcript: ENSLACT00000017604
Sequence length 1155
Comment pep:novel scaffold:LatCha1:JH126865.1:1248872:1294331:1 gene:ENSLACG00000015390 transcript:ENSLACT00000017604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRQRNSLNDELIQAQREIERQCELLVRAAKEKEDLTKDKASLVVQLTASERENRALAEE
GAGLRSEKEALETTLYDIQQQLTQLETRKEQLEGENQIILLAKEALQAEVSRVRKEMEVE
MTKLERDRELLTQKLAHTEQEAQVTLKNEQASHEEDVDHLQREKEGLRLEMEAEREELFH
RLTQEREELVARHEAEKDELSEEITSLQQERDESLLISENEKQQALSLKESEKTILSEKL
SNLQHELASSAMEIERLKRDALNRQEQDRSTINDLTAELKSFREQFEEAVMAHEREVEEL
KVQLRIAEDARDGIRRDLIEAQRRIRESQESHEIQRKEILDLKRALSDEVKEKEAVQRSN
EELRACIKKTESDRISLKRVVGEREQKLCVLEEAKTIIEKEVSDLRAGLREVEKSRLEAR
RELQELRRQVKMLDSENTKKSKEVAELQARVALDEQREEESRRESFGLKQKIVETEASRE
SARKEITNLHRKISEIENEFRVREKDLLSSLEEARGNEKKLLDNAKNLEIKLDNACGDIS
ELSLKLSAAEGRINGLEAELARVEGMKRDVEFKLGSLHSALRRTLGISRTGRTHSPAIRG
HSYSPQRSRSPPKAGTPERSPGSRPVSPERSFSPTRSEQFVADIDPEVVRAALRDFLQEL
RDTQRDRDENRIHVSNLTRQLGEMEADRDGVNLRLQQLQKSLAESEEGKRGADGRLSSAQ
TALMLQEETIRRNERERKGLLDKVATLERSLQSSESDKRALQEKMNKMKANEAKLENDKR
KLKEILDASESRATKLELVRRSLEGELQRMKLVMGDRETEIQTLQDRIETLQRQVAESET
KANSLKLAVDKVTASLARAEDNEKSLREKVQTLSISLSESNASTSSFQEKMLQLQKALTA
SEHDRRILQERLDVARQAVSEAKKQNALLLDRVQVLQNEQSELELQQVELEGQIRQNQEM
LRQHQESEDAALRNIQKLQEEKQVFQERLSSLQRALAQLENEKREVERSSVRLEKDKSAL
KKTLEKTGGEGQCIKLCCIESNCNQQEVIKFSNYSTLFLNLVLNNICQYILIYTAKPNEI
FFFQHCQTPTARHRQELQLETERLRSAQLQAERTLEARERAHRQRVKGLEEQISTLKDQL
QQELRRRQPHYSHSS
Download sequence
Identical sequences H3B6F5
ENSLACP00000017476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]