SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017884 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017884
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-28
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 223-362
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-25
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 16-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.01e-16
Family First domain of FERM 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017884   Gene: ENSLACG00000015755   Transcript: ENSLACT00000018014
Sequence length 614
Comment pep:known_by_projection scaffold:LatCha1:JH126849.1:1348950:1423494:1 gene:ENSLACG00000015755 transcript:ENSLACT00000018014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLNFQNNKVMQDRRSVCVFLPNDETLNIIVNVKALCQELLIQVCDLLRLKDCHLFGLS
VIQNNEHIYMEPAQKLYKYCPKEWKKEASKGIDQFGPPMIVHFRVQYYVENGRLISDRVA
RYYYYWHLRKQVLQSQCTLKEEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVI
ARRGKEYILKHIPHMHKDQFAVTASEAHLKYIKEAVQLDDVTVHYYRLYKDKKELEASLM
LGLTLRGIQIFQNIEEERQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGCPM
RSRHLLQLLSHSHRLYMNLQPVLRQVRKLEENEEKKQYRESYISDTLDLDIERLEKRSRA
SGSSAGSMKHKRLSRHSTTSHSSSHTSGIEADTKHRDLGPEDSFSGTAVHRRLQTCSSMT
SHGSSHTSGVESGGKERLEDDSQDDEIEMLVDDPKDLEQLNEPALEVSPDMCIHITEDML
MSRQFNGHSGLVVKEISSSTSSSSETVVKLRGESIASLPQTVCRKPKTSTDRHSQSLDDV
RLYHKDFLQIAGLCQDTAQSYTFGCDYEADEGGLYCNGCLADQCINIKESFPVKRTSKYF
SLDLTNDEVPEFVV
Download sequence
Identical sequences H3B7L3
ENSLACP00000017884 XP_005996039.1.90931 XP_005996040.1.90931 XP_005996041.1.90931 ENSLACP00000017884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]