SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018521 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018521
Domain Number 1 Region: 40-183
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.33e-39
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 366-461
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-22
Family Ras-binding domain, RBD 0.0011
Further Details:      
 
Domain Number 3 Region: 310-379
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-16
Family Ras-binding domain, RBD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018521   Gene: ENSLACG00000016306   Transcript: ENSLACT00000018654
Sequence length 566
Comment pep:known_by_projection scaffold:LatCha1:JH126685.1:1521827:1543210:-1 gene:ENSLACG00000016306 transcript:ENSLACT00000018654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLHYLYLLSCCPGTLAQSFVYTDLNSPEVDCCGSNQSLNSLPSGQTNALCSEHSVASWAV
SFERLLQDPDGIKYFTEFLKKEFSAENILFWQACENFQQIPVEDTEQLLQEARIIYDTYL
SRKASSPVNIDKKAWMDEEMLNSPTPDMFKVQQLQIFNLMKFDSYTRFVKSPLYQECMLI
EVEGRSLSDLNNSPKSHNASNSITDDSVALYDSTKKKKKLKQGKSLPVGVKESPEKKELQ
LTNRFQKSPGKSSRKKENNDASQLRRMSQGSVNSTASLELGILPSLSNRTESEKESPSRL
DLERENKAIKYCCVYLPDGTASLASVRPGLTIQEMLSGICEKRGISIIDVKAYLAENDKK
PLKLDQESTVLTDLEVRLENRTRFELELSPSKKVVLTAKPNKKVSEVLQPILLKYGFNVY
EVVPRLSGEHKALDINIPVSKIANNKINILKINLDEATENHTYTQFGLLKLALTELHKSL
KLFYFLKKYMSIVFEQQHNSVSIVNVIKNNERPKGKNHAHRRTYEFEGLLELLSKAQSSR
VDDQRGLLNKEHLVLPTFLQLPNQKD
Download sequence
Identical sequences H3B9F0
ENSLACP00000018521 ENSLACP00000018521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]