SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020989 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020989
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-25
Family Ras-binding domain, RBD 0.0000403
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000020989
Domain Number - Region: 200-319
Classification Level Classification E-value
Superfamily t-snare proteins 0.0212
Family t-snare proteins 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020989   Gene: ENSLACG00000018442   Transcript: ENSLACT00000021129
Sequence length 401
Comment pep:novel scaffold:LatCha1:JH126587.1:3312256:3317042:1 gene:ENSLACG00000018442 transcript:ENSLACT00000021129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWADGVQKVICGVNESTTCQEVVIALAKAMDRTGRYTLKEKFKDFERHLTPNEKLL
PSLSKYGQQANDVQLILNRTGPSQMDGSVLDCKGQAPERNIYRQSLPPLTRLRNKIDPNP
EAKKPKRKSLTFAEEAKVWMESFSKTKLNETNKKELDFNQNKIEDLHKIISIQHTTLHSI
QVQLETTETEIRKWENHQLSFRKEMEKLQSLVELRQTEVEELEFWENELQAEEFHEKDLK
DQFEEIKEKVQECNEKLNECSIKIHGLEGNAEAGKIMQVTKLVKELSFKSNESTVLQSNV
DLTEQSLEKANQQLQKQQLELEELTKEVCQTNLLQFIHHGTAATVSPPMQRSEETDNKGR
KKTAKDSTTQLPAPKCKQLPSKQKNYQNSQHFSFDQGGIYV
Download sequence
Identical sequences H3BGG8
ENSLACP00000020989 ENSLACP00000020989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]