SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021597 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021597
Domain Number 1 Region: 188-357
Classification Level Classification E-value
Superfamily Fibronectin type III 5.27e-18
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 2 Region: 4-183
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000397
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021597   Gene: ENSLACG00000018976   Transcript: ENSLACT00000021738
Sequence length 468
Comment pep:known_by_projection scaffold:LatCha1:JH126571.1:5945747:5970848:-1 gene:ENSLACG00000018976 transcript:ENSLACT00000021738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVPPSIHIEDKSDSSISLALKSNLDIKVDTYAVDISWVFDTHVEEKRSYRNPGGNSKLK
VNNLTAGTFYEIAAWVKTSIGDSPMSFTRVQTLGEKPSPPNLRAKAMNQTAVNCSWTGPK
NVIYGVFFATSFLELYKHPKNVTTTSNRIIVTVDSDEQYLFLVRVVSPYQGPPSEYVAVR
MIPDNRLPPRHLHAFKIGETAASFKWQPPYDYPNQDLTYAVLVKDSIRKTESHYKVTTRN
NTVEYSVTKLEPGGKYTVIVRLANMSKEASITISTVPLAAPEALKIITERDHILLFWKSL
RLKDRNFNESRGYEIHMFDSVANTSTCVGNTTDNFFKISNLKVGHNYTFVVQARCVYNGQ
ICGEPAVLLYDELGAGAVPSMSKSVKSTDVAVIVVPVLFLLLIAMGVGFIVLYMRHRRLQ
NSFTTFANSHYNSRLGSAIFSSGEDLGDDDEDSPMITGFSDDVPMVIA
Download sequence
Identical sequences H3BI76
ENSLACP00000021597 ENSLACP00000021597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]