SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000022616 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000022616
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-31
Family Ras-binding domain, RBD 0.0000066
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000022616
Domain Number - Region: 150-298
Classification Level Classification E-value
Superfamily Tropomyosin 0.0399
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000022616   Gene: ENSLACG00000013466   Transcript: ENSLACT00000025618
Sequence length 420
Comment pep:known_by_projection scaffold:LatCha1:JH127283.1:859796:886623:-1 gene:ENSLACG00000013466 transcript:ENSLACT00000025618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGVQRIVCGVTEATTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPQENPI
ISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPINDKSI
KRKEPKRKSLTFTGGAKGLMDIFGKGKETDSKQKVINNFRTAAEDLKKLIHLQTEKLQSL
ERQLDSNEAEIRFWEEKNSSCNLDEEIVRLEQRIKRNEVEIEEEEFWENELQIEQENEKQ
LKEQLLEMRQRIQDCEEKLNDYMAKIQNMESGIEAEKLQQEVQETQVNEEEVKANIEKIR
GEISIQGQQTVRLENGIKAVERSLGQANKKLQEKEQELEQLTKELRQVNLQQFIQQTGTK
VTVLPAEPLEEETSQNEGDKEATVQTSSLKRPGSVRQLPSNLRILQNPLSSGFNPEGIYV
Download sequence
Identical sequences H3B076
XP_006001770.1.90931 ENSLACP00000015297 ENSLACP00000015297 ENSLACP00000022616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]