SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000023442 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000023442
Domain Number 1 Region: 626-1051
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-121
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000648
Further Details:      
 
Domain Number 2 Region: 291-624
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.57e-81
Family Lipovitellin-phosvitin complex, superhelical domain 0.0000000385
Further Details:      
 
Domain Number 3 Region: 25-291
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.1e-78
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000158
Further Details:      
 
Domain Number 4 Region: 1347-1517
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-54
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000023442   Gene: ENSLACG00000015239   Transcript: ENSLACT00000026301
Sequence length 1822
Comment pep:novel scaffold:LatCha1:JH126745.1:1206978:1243724:-1 gene:ENSLACG00000015239 transcript:ENSLACT00000026301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMGGIILALTLTLVGSQHLSYEPAFDDSKTYVYNYEGVILSGLPEKNLARAGLRIHSRV
EISGGAQRSCILQIRDPHIEEFNGIWLKDAFTQSPKLTRVLAEDLTKRIKFEYNNGRIGH
IEAPADMSETAVNIIRGILNMLQITIKKSQNVYEIQEAGLGGICQTNYVIQEDKRTNQIT
VSKSRDLDNCHEKKMKNIGMSYLQVLSTRQQQEKNMRGAAAYIYMIKPKANGALIDKVTV
REQHEFTPFNELDDAAVTEARQKLVLVDIRNTPLALPQIQLQSRGTLQYQFATETLQIPI
QLIRTKNPEQEIENILQHLVQNQQTSGSDTPAKFLQLVQILRMITHENVEAIWKQHVRRT
EYRCWLLDAVPAMATPAALKFMKQRIQNHEISHIEAVQALITTMQTVKTDRQALETAAEL
VSSERIQKVPILRKTVFLAYGSMVYRYCFPMDSCPETALQPLHDLAVEAVSKAHEEDMVL
ALKSIGNAGQPASVKRIQKFIPGFAPGATDLPVRVQVAAVMALRNMAKKEPRKVQEIALQ
IFLNCKLQPEVRMLACVALFESKPSIALVASAANALLKETSLQVASFAYSHMKALTRSTA
PDLKEVAAACNVAINLLNPKLDRLSYRYSRALHADGFRSKWMAGAAVDFFVINSAASILP
SSVVSKIRGYAVGATADILEVGVRAKGLQDVLLKSRESFSGIPSKKKIEDILKKLANWKA
LPADKPLISAYFKLFGQEIGFAEINKEYIQEAFQFGTAPSEKHSKVSKYVRQLQNGIAAQ
WSKPLLMAEARRILPTCVGLPMELSLYSAAVSAATINADAQISPPPSADFRLTHLLNANI
RLRAQVTPSVDIHNIVVMGVNTQLIQTGIEVHGKVCMTTPLKFTAKIDMPERSLKLETAP
SQQETEMVVLRGEVFAVTRNIEELSSARKSLVLSASATNIMRQHFRSAEKASQETAKAVA
RLSSEMMSLEDPYSAEQASRHMAASSADHYACAKAKTFGFELCFLAKTKNAAFIRNSPLY
RVFGEHEAKVILKPDHSSIAIDKIQIEIQTGARAVSKLFRGMETDEMNEDSGEAQGKMVL
LQLRKIFASEFEKKDLGKNGTKTHRSSSSSSSSSSSFSSRKHSKKFSSSSNQEPGITREK
TDGIENLRARKRHQSRSSSSSSSITRSKSSSSATLSQRNSEPRLSNEETRKMQPQRENAR
HSNMDKEAWSHKQRSKGGRSSSSSSSSSNKSSRSSSSSRRSSRRSSSRSSSSKSSSASRA
SRYNSERKHHKGSSSLSRSASSSQSNSRAGSKERPYRAFVEYNFKPSRVNKRSSRRTSSK
SSSESSESSESDNDMSKQPKFPEGSTPPVLAIVTRAVRSDGKQQGYQIAAYANFRSSKPR
VQVLAMELAKSDRWRVRVDGILLSPHKAMGIIKWGEEGKNYKVVVKAQTGQFAAHPAVQV
KVDWTDVPRTVKETVRAADKYLPGAAYLAGFSEKWRRNPSHQVAVILASASSRTIDIVVK
LPQMTLYRQAIPVPLPLPGRTIQYPTSQVQPLGWNLITELPKLLTDEATTQCTVEQNTIK
TFNNVTFDYSMLGDCEHILVEDCINMSFLVMIKKAEVSSGDKQLNIKIADFEVVMYPSEG
SIKLQIDGTEIPISSLPYTDPSGKVTIKKTENGNAIILSAESLGINSIYFDDKKCKIEVS
EFLRGTVCGICGRADGERTQEFQMPDGCVAKESVSFVQSWVVPGSSCSGACQLQHDYVKL
EKQVRLHGENSKCYSVDTVLRCRRGCSPVATTPVTVGLHCVPADTTMKWTEGQMNFDQKS
EDITDMVLAHTACSCSDTSCAA
Download sequence
Identical sequences M3XL36
ENSLACP00000023442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]