SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261414693|ref|YP_003248376.1| from Fibrobacter succinogenes subsp. succinogenes S85

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261414693|ref|YP_003248376.1|
Domain Number 1 Region: 206-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.11e-63
Family B3/B4 domain of PheRS, PheT 0.0000227
Further Details:      
 
Domain Number 2 Region: 40-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.43e-39
Family Myf domain 0.001
Further Details:      
 
Domain Number 3 Region: 473-703
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.57e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0004
Further Details:      
 
Domain Number 4 Region: 713-811
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.53e-23
Family Anticodon-binding domain of PheRS 0.0019
Further Details:      
 
Domain Number 5 Region: 409-481
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000022
Family Domains B1 and B5 of PheRS-beta, PheT 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261414693|ref|YP_003248376.1|
Sequence length 811
Comment phenylalanyl-tRNA synthetase subunit beta [Fibrobacter succinogenes subsp. succinogenes S85]
Sequence
MKVSLNWLRRHVDLPESAEDVAKALTSIGLEVEGMEEPGKVYDKLLVAKVLTCDPHPDSD
HLHITTVNDGTNTIQVVCGAPNVAAGQTVVLAPIGAELPLPDGTKLKMKKSKIRGVESFG
MICAEDEIGLSDDHGGIMVLDDSIPAGTPFVSLGMYDVCFELNVTPNRPDALSHRGVARE
LAAKFNRPLKPLAYNFKEDSEAASSAISLEVVPGCGCSRYVGRVIKDVKVEKSPAWLAKL
LHAVGMNSINNVVDITNFILMDVGQPLHSFDMDQLHGNKIKVRRAVKGEHIETIDHTAHE
LIENDLVICDGDRPACVAGVMGGVESEIVDATKNVFLESAWFNPTVIRKQAKRLCISTDS
SYRFEREIDFATQDEYSKYACAMIQEVAGGRILKGSVEYTGEDHKKENNQVTLRVARAAK
VIGMEVSAEQIEKFLTGIALEVVKKDAESLTFKIPSFRPDLEREVDLIEEIARLIGFDNI
PYSLPKFTMQPNELPAIEVLNRKIRKTLSAMGLHECLSLRFTSKARTEALFGPESDDRRS
KPALLLNPLSEELGAVPTSLLPNLLKAVAENEKNRPGSVRLFEVAKGQFKRDRKDERDTG
FDESNLVALTIAGNFDVDPLNDKPKQIDFAAFKGFVQSFFKRLGLVVEFRAAAKPELFLH
PGKQAEIVCNGTVLGTMGELHPNCLKANEISYETYVMEADMDKMEHESHKKIVFQAFSRQ
VPSTRDISIEVAKSMTHEDVLARIKALNPKNLAKITLKSIYEGEKIEAGKKNMVYSLTYQ
AMDRTLTDDEVNKAHNKLRDKLVQNGDIVLR
Download sequence
Identical sequences C9RKG6
WP_012820124.1.27150 WP_012820124.1.74657 gi|261414693|ref|YP_003248376.1| gi|261414693|ref|YP_003248376.1| 59374.Fisuc_0282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]