SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000000147 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000000147
Domain Number 1 Region: 79-252
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.35e-53
Family Matrix metalloproteases, catalytic domain 0.0000000776
Further Details:      
 
Domain Number 2 Region: 300-494
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.2e-52
Family Hemopexin-like domain 0.0000262
Further Details:      
 
Domain Number 3 Region: 3-66
Classification Level Classification E-value
Superfamily PGBD-like 6.44e-19
Family MMP N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000000147   Gene: ENSLACG00000000129   Transcript: ENSLACT00000000148
Sequence length 569
Comment pep:novel scaffold:LatCha1:JH130224.1:370:133524:1 gene:ENSLACG00000000129 transcript:ENSLACT00000000148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLQVWLQKYGYLPPTDPRMSVLRSAQTMQSAIAAMQQFYGINITRKVDKNTIEWMKKPR
CGVPDQFGGSSKFNVRRKRYALTGQKWHHKHITYSIKNVTPKVGDVETRKAIRRAFDVWQ
NVTPLAFEEVPYNELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDT
HFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMDTENFRLPN
DDLQGIQKIYEKGPPDKIPPPTRPLPTIPPHCSYPPSDPRKNDRQPRPPKPPTGDKPFYP
GTKPNICNGNFNTLAILRREMFVFKDQWFWRVRNNRVAYGYPMQITYFWRGLPPDIDAVY
ENSDGNFVFFKGNMYTYLSKTPLLPGPPNSTVKLSSGFHFHNVKNQWSDLSRVFLFVLHR
YWRYNEIMRGMDPGYPKPITVWKGIPESPQGAFVDKENGFTYFYKGKEYWKFNNQKLRVE
PGYPRSILKDFMGCDRTTDKDKDHHSPQDDVDIVIKLDNTASTVKAIAIVIPCILALCLL
VLVYTVFQFKRKGTPRHILYCKRSMQEWV
Download sequence
Identical sequences H2ZRX6
ENSLACP00000000147 ENSLACP00000000147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]