SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004922 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004922
Domain Number 1 Region: 569-703
Classification Level Classification E-value
Superfamily EF-hand 0.0000000233
Family Calmodulin-like 0.047
Further Details:      
 
Domain Number 2 Region: 394-449,487-611
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000243
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004922   Gene: ENSLACG00000004377   Transcript: ENSLACT00000004965
Sequence length 890
Comment pep:novel scaffold:LatCha1:JH128070.1:120245:173101:-1 gene:ENSLACG00000004377 transcript:ENSLACT00000004965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCPKRGAAAAAIMERVRSQDRRSAGSTATHSPHSTCSRQAWSRDNPGFEPEEEMVEMDMD
WHPPASPGRRSVSTASSSSRSNNNNRRRRARGLCSTPVVDLQHLNQVSHDQGWGKKILKT
VRGLWGTTLMEGGTTSREKYLKNVLREMITYIIFLVILCLLTYGMVSSNMYYYTKVMSRL
FLETPISEGEQTNFRTLSSMEDFWKFTEGPYLNGLYWDLWYNNETLTENKSFIYCENLLL
GVPRIRQVKVRNGTCEIHEDLKDEIKDCYDVYSVGNEDTSQFGLMNGTAWTYTKESDLNG
STHWGLISTYSGGGYYLDLSKTRVESAAQIKTLKDRLWLDRGTRAVFFDFSVYNANINLF
CIVRLLVEFPATGGMVTSWSFQTVKLIRYVSAFDYFLAACEVAFCFFVLYYIVEEVLELR
IQRLHYFRSFWNCLDILIIVLSVVAIGINIYRTASVDASLGYLLENQKTFPNFEPLAYWQ
IQFNNMAAVIVFFAWVKLFKFVNFNKTMSQLSSTMSRCAKDVIGFAIMFFIIFLAYAQLA
YLVFGTQVDDFSTFQDCIFTQFRIILGDFSFTEIEEANRVLGPIYFTTFVFFIFFILLNM
FLAIINDTYSEVKADMAQQKTEMELADLIKKGCNKAMVQLRLKKTTVDDITDSLRQAGGK
LNFDELRADLKGKGHTDAEIEAIFAKYDQDGDQELTEREHQQMRDDLEKERDDLDLDRSS
LPRPASGRSFPRSLDDSEEEDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGS
IVSKIDAVIVKLEAMERAKLKRRDVLGRLLDGVTEDERLGRDNEIHREQMERLVREELER
WESDDTVSQLSHRLGTPIGMNGQPRSRSSRPSSSQSAEGMDGGGNGASHV
Download sequence
Identical sequences H3A5K1
ENSLACP00000004922 ENSLACP00000004922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]