SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007263 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007263
Domain Number 1 Region: 524-780
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-86
Family Eukaryotic proteases 0.0002
Further Details:      
 
Domain Number 2 Region: 317-423
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000994
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 3 Region: 53-145
Classification Level Classification E-value
Superfamily SEA domain 0.000000000017
Family SEA domain 0.0059
Further Details:      
 
Domain Number 4 Region: 195-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000301
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 5 Region: 462-496
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000929
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 6 Region: 429-461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000432
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007263   Gene: ENSLACG00000006442   Transcript: ENSLACT00000007323
Sequence length 781
Comment pep:novel scaffold:LatCha1:JH127986.1:218218:252989:-1 gene:ENSLACG00000006442 transcript:ENSLACT00000007323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQETNVETLSVTSGQSDKTRHLLLKSLTVVAGLLLGGIILLLWYILDFRVRHLEPKQIQF
YTGDLTILNKDFSGDYANHNSLGFKLEAAHLKRTVEHIVRSSEIASYFKTSAVFAIGQGS
IIPFFWLKLMVPNRSLEEVNAKRINVMMTKVLLDMGNSTVSKYSGYEILIDSLHIRESNP
KDVAVLKTSQGCFRYSSIHTSSTMSLLGPNYLKKSCLWNLHAPQSYKIQLKVQWLKAESH
DLLAVYNSNSMTEEQLITSLYGYSWQERKAQILSKGNHMSVLWKKSHHSFIESFSLTAQA
VPFIDCNANITLKARLGVQGTISTPYFPSYYTSNAQCTWQMTVPSLKYGIVLRFEGYELD
HIHNSQPCKQGLWTIQNNRMCGRRIFQPYAERIYLVSLTVNISFTSQISLTGPGIQAFYS
LFDQSDPCPGEILCSPTGLCVPSCDGVRDCPDNSDERNCVCPAKFKCGEGSSCVELHKVC
DQYTDCQSGSDETNCMKGVPCSYYTYKCADGTCMKKPNPECDLTSDCHDTSDEENCDCGL
QYSLNRIVGGSRAREGEWPWQASLVLQGVHVCGGTLISSRWVVTAAHCLLLNTLTPASYW
TVHLGRLYQNITTKHEVTFKVLKIITHHYYDEDTHDYDVGLMQLDQPIPNSHFIYPACLP
APSHVFPTGILCYISGWGAARESGVTENALLATSVQLIHYDVCFRAYDYRLTPRMLCAGY
QRGGKDSCQGDSGGPLMCMESSNRWFLAGIISWGVGCGRPDVYGIYTRVTKISDWIHEVI
L
Download sequence
Identical sequences H3AC92
ENSLACP00000007263 ENSLACP00000007263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]