SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021210 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021210
Domain Number 1 Region: 281-476
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.58e-65
Family Hemopexin-like domain 0.00000828
Further Details:      
 
Domain Number 2 Region: 53-241
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-45
Family Matrix metalloproteases, catalytic domain 0.000055
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily PGBD-like 1.43e-16
Family MMP N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021210   Gene: ENSLACG00000018633   Transcript: ENSLACT00000021350
Sequence length 547
Comment pep:novel scaffold:LatCha1:JH126570.1:3848002:3887240:-1 gene:ENSLACG00000018633 transcript:ENSLACT00000021350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWLTKFGYLPPPDPITGQLQTQEALTKAIQAMQRFGSLEETGIIDEATLALMKTPRCSLP
DLAETETAWRKQYAQSLTKWNKRNLSWRVRTFPKESHLGHDTIRALMYYALKVWSDITPL
NFHEVAGNNADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTSGDTHFDDDEAWTFR
SPDDHGMDLFAVAVHEFGHAIGLSHNSVVESIMRPYYQGPVGDPLKYDLPYEDKVRIWQL
YGVRESVSPTARPQVTGVADHPILPELTENSSVVLIKRDAPDRCNTHFDAVAQIRGEAFF
FKGKYFWRLTRNKQLVSLQPAEIHRFWRGLPPNMDSIDAVYERIADHKIVFFKGDRYWVF
KDNNVEEGYPRPITDFGLPLGGVDAAFARAHNDETYFFRDNLFWRYDMHQQRIEAEYPKE
TLLWKGLPRTIDDAMRWLDGATYFFKGKDYWKVLDSQMEAEAGYPQSIGRDWLVCSEMQS
DAPDSDSSRTGARSRQGHHDESRSESGYEVCSCTSSAGSAVLREAVAFSAVFLTMSVWTT
ALWSAAL
Download sequence
Identical sequences H3BH39
ENSLACP00000021210 ENSLACP00000021210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]