SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021603 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021603
Domain Number 1 Region: 337-532
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-69
Family Hemopexin-like domain 0.00000559
Further Details:      
 
Domain Number 2 Region: 124-290
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.81e-56
Family Matrix metalloproteases, catalytic domain 0.00000011
Further Details:      
 
Domain Number 3 Region: 33-107
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-21
Family MMP N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021603   Gene: ENSLACG00000018981   Transcript: ENSLACT00000021744
Sequence length 608
Comment pep:novel scaffold:LatCha1:JH126566.1:5982366:6025518:-1 gene:ENSLACG00000018981 transcript:ENSLACT00000021744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFYYTFSHGLHVSLFYHTSTLCFAQCLKVIRSHHSQNKDIPLVFQSWLKNYGYLLPHDIR
ASALRSEKAMQSAVAAMQRFYGIPVTGVLDQTTIQWMKKPRCGVPDHPHISRRRRNKRYA
LTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEIPYHEIKSERKE
ADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLF
LVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAETLEPTR
PLPTLPVRRTHSTSERKHDRQSRPPRPPSGGKPSSPGAKPNICDGNFNTVALFRGEMFVF
KDRWFWRLRNNKVQEGYPMQIEHFWKGLPSRIDAAYERSDGKFVFFKGDKYWVFKEVTAE
PGYPHSLVELGSCLPREGIDTALRWEPVSKTYFFKGDRYWRYNEEKRAADPGYPKPITVW
KGIPEAPQGAFVSREGIYTYFYKGKDYWKFDNQKLSVEPGYPKSILKDWMGCVVKDVDNS
RDRHLPNDDMDIMVTINDVPSTVNAIAVVIPCILSLCILVLVYTIFQFKNKGVQQNVTYY
RRPVQEWV
Download sequence
Identical sequences H3BI82
ENSLACP00000021603 ENSLACP00000021603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]