SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000022718 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000022718
Domain Number 1 Region: 328-521
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.06e-72
Family Hemopexin-like domain 0.00000788
Further Details:      
 
Domain Number 2 Region: 121-291
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-53
Family Matrix metalloproteases, catalytic domain 0.000000182
Further Details:      
 
Domain Number 3 Region: 35-104
Classification Level Classification E-value
Superfamily PGBD-like 1.48e-20
Family MMP N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000022718   Gene: ENSLACG00000016983   Transcript: ENSLACT00000026598
Sequence length 597
Comment pep:novel scaffold:LatCha1:JH126769.1:1841226:1889970:-1 gene:ENSLACG00000016983 transcript:ENSLACT00000026598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDLQLPNPNANFRTSFWFFWTFLLGFWGRSCLASPNSFSAEGWLQQYGYLPPGDLRTHT
MRSPQTLAAAVSAMQKFYGLKVTGTFDQETIKAMKRPRCGVPDKFGTEMKANVRRKRYAI
QGLKWNQKEITFCIQNYTPKVGEYNTFYAIRKAFKVWEGVTPLRFREIPYSEIRDNKKNF
ADIMLFFAEGFHGDSTPFDGEGGYLAHAYFPGPGIGGDTHFDLAEPWTVDNQDVTGNHIF
LVAVHELGHALGLEHSNDPSAIMAPFYQWMDIHTFQLPEDDKRGIQQLYGQTEYFPRPTV
PPRKPEKPDRPPNTPDVPTKPDQPTYGPNICEGNFDTITVLRGEMFVFKERWFWRVRHNQ
VMDGYPMPIGHFWRGLPASINAAYERKDGKFVFFKGDKYWVFTEALLELGYPKNLREMGS
GLPRDRIDAALYWLANGKTYFFRGNKYYRFNDEMRSVDADYPKSISVWEGIPESPRAAFM
GNSEVYTYFYKGNKYWKFNNQKLKVEPGYPKSVLQDWMGCDRDPVEDTPGKDTDEEVIII
EVEDMDSSLNQATVAAIIIIVLLILSVLALGFLVFIFRRYGTPKRLLYCHRSLLDKV
Download sequence
Identical sequences M3XJ12
ENSLACP00000022718 ENSLACP00000022718 XP_005994488.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]