SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|408500933|ref|YP_006864852.1| from Bifidobacterium asteroides PRL2011

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|408500933|ref|YP_006864852.1|
Domain Number 1 Region: 8-328
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 4.84e-61
Family ADP-ribosylglycohydrolase 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|408500933|ref|YP_006864852.1|
Sequence length 331
Comment ADP-ribosylglycohydrolase family protein [Bifidobacterium asteroides PRL2011]
Sequence
MTRTEKGALGALTGLSLGDALGMPTQSMSPAAIHEAYGRVDTLRDAIADQPIAPGMPAGS
VTDDTEQALIVAELIIEGRGHIDPKEFAKRLLAWEDGMKSRGSLDLLGPSTKLALEQVRH
GADIMTTGRTGTTNGAAMRVAPVGIANRPEDTRRLANRIYESCQVTHDTVTGFQSAALIA
TTVSLGLEGMTVRQALNESLRLVPAMETAGAWTPKASVPARARQAIQVSEEFSDEDDFER
HLIEDCGTSVEANESVAAAFALAWRFADDPQSALFVAVNLGGDTDTIAAMTGAMTGACTG
PEVFDPALCSQVASVSHLDLQKTARGLITLR
Download sequence
Identical sequences A0A0F4L1Z0 K4IQE2
gi|408500933|ref|YP_006864852.1| WP_015021725.1.57405 WP_015021725.1.63146 WP_015021725.1.9333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]