SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_00420T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_00420T0
Domain Number 1 Region: 245-410,440-490
Classification Level Classification E-value
Superfamily TPR-like 2.28e-28
Family Tetratricopeptide repeat (TPR) 0.0038
Further Details:      
 
Weak hits

Sequence:  LOAG_00420T0
Domain Number - Region: 88-133
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0222
Family N-terminal coiled coil domain from apc 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_00420T0
Sequence length 553
Comment | LOAG_00420 | Loa loa V3 kinesin light chain protein 2 (554 aa)
Sequence
MTALSQEEILQSTRTVVQGLEALKDEHESIKGTLVNSIQGLNADESALIEEKTHIVDRNL
EMLRLGIEEAQVMMALAGHLQTVEAEKQKLKAQVRRLCQENAWLRDELNSTQQKLQATGQ
QVAQLEEEKKHLEYMNSIKKYDDQQENDKTMDQSDNRSDNTLQDLGFGPEEDEEISGHMT
GQFAHPTPAHSMAASASAGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTS
GHDHPDVATMLNILALVYRDQNKYKEAANLLNEALHIREKCLGESHPAVAATLNNLAVLY
GKRGKYKDAEPLCKRALEIRENVLGADHPDVAKQLNNLALLCQNQGKYDEVERYYKRALE
IYEAKLGPDDPNVAKTKNNLSSAYLKQGKYKDAEILYKQILTRAHEREFGKVADDNKPIW
QIAEDREENKHKGGGDTSTYQEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETL
EDAALRAKKQHEPPVSGHQSALTATSTYADDSLMSSVVASQASRGMTQSQSSSGLKSRLF
NALGLQQQQQQLP
Download sequence
Identical sequences A0A1S0UBJ9
LOAG_00420T0 XP_020304113.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]