SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_00563T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_00563T0
Domain Number 1 Region: 105-227
Classification Level Classification E-value
Superfamily PapD-like 2.43e-25
Family MSP-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOAG_00563T0
Sequence length 323
Comment | LOAG_00563 | Loa loa V3 hypothetical protein (324 aa)
Sequence
MDELARCIPQQSPSNEPINDDEQHTLQNDITDSGDVSSNSTTYFNKLGFKRSVTFEEEDT
NRGTSLTSASQLVPSITKRNGLPQALRHLAETRLHTPAKDYAKVKFLSICPREELTLNYV
NGENDMADIVVLKNESVRNVAYKIKITSPEKFRVRPSTGTIAPGATEFIRVYLQNEFRNS
VPREKLLLMAVETSGESEVFGNVWKHSSDEAKIEHKLRCRLSTESGMTMSSAELMDSTVN
GNENNLPTSTKESHFITLLFTIFFRITFFKIGTNNAHEKKGSFEGSQGQEAEKAVTQFQD
CCHLNLGQKLCFSVSSEIYHVTY
Download sequence
Identical sequences A0A1S0UD14
XP_020304070.1.37734 LOAG_00563T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]