SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_04513T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_04513T0
Domain Number 1 Region: 25-60,291-373
Classification Level Classification E-value
Superfamily TPR-like 0.0000000107
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_04513T0
Sequence length 487
Comment | LOAG_04513 | Loa loa V3 hypothetical protein (488 aa)
Sequence
MTPTSRDDEFVDKKVDEGGVLKFQMLLAEGKQAYISGRFKEAETKLSEAAELSVNIYGYF
TIPTFEPHLYYGKTLLELARLEDGVFSNALQGITATGEEVCKKRTNDKDDDIEEVQSLTE
EERAETVERVENAWEENAEALEEKIACCRVDSSGMLENNKEESEEKRADVDAVKNEADVT
MEGDRSSTEKEQTKGDYVVKTDKEDEDETMGHKEKRSNTEGERDENMEDEKKEGNDGVED
EKEDDKLDEGGKDGISEENNSKDESSNAEDVEYLQLAWENLEVARTICDKHLEEEGWKEK
KVEVLLDLADCSTDAENYKQAVDDIDACILLTKSIFGEIDRRVAQAYFVKGRTHNLAKDF
GNAAKVFGKSKEILEARLTELESQLANASQGEAEKIKKEVYELKPLLPEIQTKIDDSLES
ERSLTKESIFAGDEGDISLKSSVGGMPIDDVSNLVRKKLKRSAEDEAQRKPKKTKASGDV
ENAAVDS
Download sequence
Identical sequences A0A1S0U2F5
LOAG_04513T0 XP_020303067.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]