SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_04786T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_04786T0
Domain Number 1 Region: 47-115,213-449
Classification Level Classification E-value
Superfamily TPR-like 3.22e-18
Family BTAD-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOAG_04786T0
Sequence length 537
Comment | LOAG_04786 | Loa loa V3 TPR Domain containing protein (538 aa)
Sequence
MHSFYEDISKLFGFELYDDVITLYELSYAEQMLNNMQAATVVSMVAESYYQRDSFIKSQE
AFYRAITLAKALSKPLSKDLKFSEAELKYRLHRCLLKQRKREEAMGVLGSIAEEEMTPKV
MSALARLHHVPSNDYTSRDKVKTVGNAMLYHKKVVELCPEAIDSLSSIVRYGLKEGVCIS
HRNRTVQAWLKAQEAVAEQKHYDAISHLSGVPPGNLKILIELGRLHYTVGENQKASVYLR
RAHHLDPSTSYSMDILAFILAQEQNYKDLENLAATLMDAQETPEAWVAYAFLAKCQKRHD
KALYFTEKACKLADWHVHPMAVLLRALILMDKKKFDEAIAELRDALVIHPANYTLYEALV
HAFLLQEKTQEARIVACTCRHVLGQDNARALYLCATLAAKDESTVKDAQKLLEKAIAISP
HLLDAVFLLVALYDKTQSYEKAITLLKKQTETTVNSRLHRLLGDFLTKTNRPVDACHQYR
LAVDGDVSAAQAMDALEGIFGMNTPECLASVICPGAPRRRTGQVCHSDQTPVTERNI
Download sequence
Identical sequences A0A1I7VMP1
LOAG_04786T0 XP_003140371.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]