SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_06247T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_06247T0
Domain Number 1 Region: 69-172,321-537
Classification Level Classification E-value
Superfamily TPR-like 4.22e-28
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_06247T0
Sequence length 580
Comment | LOAG_06247 | Loa loa V3 hypothetical protein (581 aa)
Sequence
MTTKGWDSMRWGKWIVVGGACIASGAAVWWYVRKQTRNAVNGSKNNVRPTASVAPCPVLF
PGMQSSKEVKDRGNEYFKQCSYKKAAEAFTEAISLCPPEYKNHLAVCYQNRAAAYDRLGD
PARSIVDCTKALGLDPLYFKAVVRRAKAYLSLSRPEEALDDLTYAFVMNPEASESLKTDV
DSAVALAAANLVEHVKNTRESIPVRDELVLLWRSSYVNDPILRDLKEESHSSSPYDQALE
AIRQRHYEEVIPLIENDLLVQQSDPNHLNVTSILRDYILQARFALMKENVMSLKERLAAF
DSMWNTLNEDSQCEITNKRFRSMYHILLAAWKILEHCSDVESEFNRAVEIDRTNVDIYLG
AALLLSENGQLQEAIDYLDQLNKIDPTHHLVKHMRANCKMALKASVGDVGGAMACMTKVD
QLLQMNENADPVLYLITGRLYYAAQNKDLAKASFKKAAESIPDYAAPMFYLAMVEAEEME
GSPNQMAVLESKMKVCLEREKANPDALAILAKIAFQRQQLDEALHLYEQCIEVCPVHTNE
ASLLPAVTDYVQIRSLRKAVEKLQQTAAPPVDASCSILET
Download sequence
Identical sequences A0A1I7VZ86
LOAG_06247T0 XP_020302635.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]