SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_12476T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_12476T0
Domain Number 1 Region: 57-227
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000664
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number 2 Region: 269-360
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000365
Family Fibronectin type III 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_12476T0
Sequence length 425
Comment | LOAG_12476 | Loa loa V3 hypothetical protein (426 aa)
Sequence
MQFWMDTNAYASRTEHSPIKNVQLGCMDVVTSQEHNNFEDTIEGLIFININETEQYPIRY
IIQWKQRTYDGSITGENGWITASIESEPIIKVEGMIPIMQYRFMVTAVGPGGRLGGPIMS
NWAQTLTIDEKLHVPVGPMMITTQYNNEDGLCALIKWYHSPYQREPSSDISDDRRAMFGN
CHYSITILNETSRETVLFTLDNGNGILLSNLQFSTEYSVAIRSISSAMTVNSLLLHQKNM
STAGDTNGILEQKFLTPACNEVFGSGSLECAPEPVKNLEAMVNSNGSVNIKWIPSSEPNT
VLVYQLLYQSLTNHYDCDKDSSSIYINAGSTTATIQLHGRTHCEYSIKLINYDLIGREAS
TEIIIWYRPDIHVFNSNLIYTYPILILMSIISLLKCCICLCCPTTTNNRSIILSGCNKKD
TVTIL
Download sequence
Identical sequences A0A1S0TL48
XP_003148037.2.37734 LOAG_12476T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]