SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_16726T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_16726T0
Domain Number 1 Region: 291-594
Classification Level Classification E-value
Superfamily TPR-like 1.08e-25
Family Tetratricopeptide repeat (TPR) 0.009
Further Details:      
 
Weak hits

Sequence:  LOAG_16726T0
Domain Number - Region: 198-254
Classification Level Classification E-value
Superfamily TPR-like 0.00596
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 
Domain Number - Region: 135-193
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 0.0471
Family N-terminal domain of DnaB helicase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOAG_16726T0
Sequence length 681
Comment | LOAG_16726 | Loa loa V3 CBR-EMB-27 protein (682 aa)
Sequence
MRGGTNEIIFSHRHLHLDEMVGRSAIKQRPIPTRESTIEDLARTPTSLPTSSTSALSAPL
DVPSQALLTSDGNCGFSEIDSLIQRYLASTQYKTALFWADKRLALCRKNGSQPSFVDMAR
FIKVLAAAGEWTRLMAYCDRHELIMKHMFFAYFYDRYHDLVFSVMPHMVQLSKPKSFVPS
SEEITALDKISEDLKIEAGLLLLLGKAYLMTQNRRAAFSCLQGAVYKDDSCIEAFELIQK
YRLYSKQRFEELIKRSGDKSSMVVVLRNHYFSQGNENLDSDASVNEALVTDLSILTARAA
HLYQIGDLTGAYNITNEILNEAGMFQDCLLIHIATLVQLRKFESLFILAHKLVDSQPDNE
ISWYAVGCYYYSIGQLGAAKNFLNKCTSMNCAFGEGWLAFGHALTAESEHEQAMNCYLRA
SRVLEGSFEPLLYIGLEYAYANNTKLAQDFLKDAAEIAGDNALVLHEQGCICYMEKEWRN
AETFFTKALLLAYNETNENALCDLLNRPLSEFWEPLVNNLGHVKCKLGSYEEAVKFHQKA
LLMCPGKLGPSAGLAIAAGRAGDIDRAVHYFHKSLSVDPHNKVLEQGLHHLMHFLGTHVN
FLASCIRTPTVMTGLFEKFLVTKADLEGDSDEKQAQQKALETLKRKRTKRGSQEDCGRKM
LDQRPKNFPAHVIIPTDVEMT
Download sequence
Identical sequences A0A1S0ULJ6
XP_020307106.1.37734 LOAG_16726T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]