SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_17351T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_17351T0
Domain Number 1 Region: 11-39,215-487
Classification Level Classification E-value
Superfamily TPR-like 3.8e-34
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOAG_17351T0
Sequence length 500
Comment | LOAG_17351 | Loa loa V3 hypothetical protein (501 aa)
Sequence
MELNPLLRALLHFKHNNTEKAIKICSDILEKNPCDQAAWSLKLSCLTEEFYVDELENDER
GVAEIFLDDTVLASKTRPGTSLSRPVTSGQTSRQAIRPISSNGRPLSGVLRPETHVRPGT
MEQTLRTSRTSRTTRATSSSSARFSRLGTASMISEPNGPFVNLSRLNIDKYAADPQVNRN
LFEYVFYHEGDMKVAHQIAVIATKSAGNTDWYWKNQLGKSCYRLGMFNDALKQFHSSLNN
QQMAETYAYLAKTYCRIDQPLMAIDQYNSGLQIFRNDITLLIGLARIQEHLGDIENCIKA
YKLVLEQDPTNVEAIACIATNYFYNDQPEIALRYYRRILQMGVNSAELFMNLGLCCFFCQ
QFDLALSCIERALASASDEVIADVWYNTGNVFLSSGDVKMASRCFRLAIAADPNHAESVC
NFAILQMRDGKIDQSRSMFRSAIEKGPHLFEPCYNLALLTYQIGQFDESRTMVLKALELY
PDHVHSKTILGHIEQMFHML
Download sequence
Identical sequences A0A1I7VR54
XP_020306382.1.37734 LOAG_17351T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]